KEGG   Dinoroseobacter shibae: Dshi_3420Help
Entry
Dshi_3420         CDS       T00612                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dshi_3420 (glpK)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dshi_3420 (glpK)
Exosome [BR:dsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dshi_3420 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3599365..3600924
Genome map
AA seq 519 aa AA seqDB search
MDRQRGQFLLNLRALKPRPGEGTVRHVLAIDQGTTSSRAIVFDADMNIVSIAQEEFAQHY
PDSGWVEHDPEDLWDTVLRTCRNVLERTGLAATDLAGIGITNQRETTVVWDKSTGKPIHN
AIVWQDRRTAPFCAELRKAGHDALITAQTGLLADPYFSGTKLKYILDTVEGARDRAKAGE
LLFGTVDSFLIWRLTNGAAHVTDATNAARTMLYDIHKGAWSAEICTLFDIPLGMLPQVHD
CDAEFGTCTPEHLGGAVPILGVAGDQQAATIGQACFEPGMLKSTYGTGCFALLNTGEAPV
TSTNRLLTTIAYQLDGKPTYALEGSIFVAGAVVQWLRDGLKLIANASETQPLAEAADPHD
PVILVPAFTGLGAPYWNAECRGAVFGLSRGSGPEEFARAALESVGYQTRDLLEAMHKDWS
DAREGQPTLRVDGGMTASDWTMQFLADIIDAPVDRPKITETTALGVAWLAGQKAGLYPDR
AGFAANWALDQRFEPKMDATTRDTKYAAWKRAVAAVQQA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgacagcgcgggcagttcctcctaaacctgagggcgctgaagccacgaccgggg
gagggaaccgtgcgccacgtgctcgccattgaccaaggcacaacttcgagccgcgccatc
gtctttgacgcggatatgaacatcgtctcgatcgcgcaggaagaatttgcgcagcattat
cccgatagcggctgggtggaacacgatcccgaggacttgtgggatacggtattgcggacc
tgtcggaatgtgctcgaaaggaccgggctggctgctacggacctcgccgggatcgggatc
accaaccagcgcgagacgaccgtggtttgggacaagtccaccggcaaacccatccacaac
gcgatcgtctggcaagacaggcgcactgcccccttctgcgccgaattgcgcaaggctggg
catgatgcactgatcacggcgcagaccggccttctggcagacccgtatttctcaggcacc
aagctgaaatacattctcgataccgtggagggcgcgcgcgaccgtgccaaggcaggggag
cttttgttcgggaccgtcgacagtttcctcatctggcggctgacgaatggggccgcccat
gtcaccgacgcaaccaacgcggcgcgcaccatgctctacgacatccacaagggcgcttgg
agcgcagagatctgcacgctgttcgatatccccctcgggatgctgccgcaggtgcatgac
tgcgatgcagagttcgggacctgcacacccgagcatctgggcggcgcggttccgatcctc
ggcgtggccggggaccaacaagccgccaccatagggcaggcctgctttgagccggggatg
ctgaagtcgacttatggaacggggtgctttgcgcttttgaacacgggcgaagcaccggtc
acctcgaccaaccggcttctcacgacaatcgcctaccagctcgacggaaaaccaacctat
gcgctcgaaggctcgattttcgtggccggtgcggtggtgcaatggctccgcgacgggctg
aaattgatcgccaacgcgtccgagacgcagccgctggccgaggccgccgatccccatgat
cccgtgatcctcgtgccagccttcaccggcctcggggcgccctactggaatgcggagtgt
cgcggggcggtctttggcctctcgcgcgggtcgggtccggaagagttcgcccgcgccgcc
ctagaaagcgtcggttatcagacccgcgacctgctggaagccatgcataaggactggtcc
gatgcccgcgaagggcaaccgaccctgcgggtggatggtggcatgaccgcaagcgactgg
accatgcaattcctcgccgacatcatcgacgcgccagtcgaccgtccgaagatcacggaa
accaccgcgctgggtgtcgcctggctcgccgggcagaaggccgggctgtacccggatcgc
gcgggctttgcagccaactgggctctggatcagcggttcgagcccaagatggacgccacc
acacgcgatacgaaatacgcagcctggaaacgcgccgtcgccgccgtgcaacaagcctga

DBGET integrated database retrieval system