KEGG   Dinoroseobacter shibae: Dshi_3503Help
Entry
Dshi_3503         CDS       T00612                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dsh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3683499..3685220
Genome map
AA seq 573 aa AA seqDB search
MIPPTHMDPVERWAQAATAAALLAIDPEGLGGLWLRARSGPARDRLLAGLRGLLTAPRRM
PPGIADAQLFGGVDLAATLSAGQLVRAPGLLGSGPVALIAPMAERMTPGLAARLAQTLDA
SQGHCLIALDEGAEPDERLAASLADRLALHIDLDGLALADCPPPAFDAEEIARARTYLPH
VRLGPDAHAALTVAALRLGIDSLRAPLLAARAARALAALDGRDTADEDDLVTATELVLAP
RATRFPEEDTDEAEPPQDAPEPPPETDAAPEDELDETDPPQRLPEEILLQAAKAVLPPDL
LARLAAAKAPKTAKSGAGAGAAKKGNRRGRPLPSRPGRIDGQSRIDLVATLRAAAPWQTI
RRKLTPDAPQKVLVRSEDIRLRRFEEKSDRLLIFAVDASGSAALARLAEAKGAVELMLAE
AYARRDHVALIAFRGTGADLLLPPTRSLVQTKRRLAALPGGGGTPLAAGLRASLDLAALS
KGRGLSPTIALLTDGRANIALDGTANRPAAAEDARAMARALRAQATPSIVIDMGNRPQAQ
LRDLAGDLAAPYIPMPRADSQRLSTAVTAALDS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccgcccacccatatggacccggtcgaacgctgggcccaggcggccaccgccgcc
gccctgctggccatcgaccccgaggggctcggcgggctgtggctccgcgcgcgctcaggc
ccggcgcgcgaccggctgctcgcgggcctgcgcgggctgctcaccgccccgcgccgcatg
ccccccggcatcgccgacgcgcagcttttcggcggcgtggacctcgccgcgaccctgtct
gcgggccaactcgtgcgcgcccccggcctgctcggcagcggccccgtcgccctgatcgcc
cccatggcggaacggatgacgccgggccttgccgcccgcctcgcccaaaccctcgatgca
tcccagggccattgcctcatcgccctggacgaaggggccgagcccgacgaacgcctcgcc
gcctctctcgccgacaggctcgcgctgcatatcgacctcgacgggctggcgctggccgac
tgcccgccccccgccttcgacgcggaggagatcgcccgcgcgcgcacctacctgccccat
gtgcgcctcggccctgacgcccatgccgccctcaccgtcgccgccctgcgcctcggcatc
gacagcctgcgcgcccccctgctcgcggcccgcgccgcccgggcgcttgccgcgctcgat
ggccgcgacaccgcggacgaggacgacctcgtgaccgccacggaactggtgctcgccccc
cgcgcgacccgtttccccgaggaggacaccgacgaggccgagccgccccaggacgccccc
gaacccccgcccgaaaccgacgccgcgcccgaggacgaactggacgagaccgacccgccc
cagcgcctgccggaagagatcctgctgcaggccgccaaggccgtcctgccgccggacctg
ctggccaggcttgccgccgcgaaggcccctaagaccgccaaatccggggccggggccggg
gccgcgaagaaaggcaaccgccggggccgccccctgccgtcccgcccgggccggatcgac
gggcagtcccgcatcgacctcgtcgccaccctgcgcgccgcagcaccctggcagaccatc
cgccgcaagctgacccccgacgccccgcaaaaggtgctggtccggtccgaggatatccgc
ctgcgccggttcgaggaaaaatccgaccgcctgctgatcttcgccgtggacgcctccggc
tccgctgcccttgcgcgcctggccgaggccaagggcgcggtcgagctgatgctggcggag
gcttacgcgcgccgcgaccacgtcgccctcatcgccttccggggcaccggcgcggacctt
ctgctgccgccgacccggtcgctggtccagaccaagcgccgcctcgccgcgcttcccggc
gggggcggcacaccgctcgccgcgggcctgcgcgcctcgctggacctcgccgcactcagc
aagggtcgcggcctcagccccaccatcgcgctcctgaccgacgggcgggccaatatcgcg
ctcgacggcaccgccaaccggcctgccgccgccgaggacgcccgcgccatggcccgcgcc
ctgcgcgcccaggcgacaccctcaatcgtcatcgacatgggcaaccggccccaggcgcag
ctgcgcgatctcgcgggcgatctggccgccccctacatccccatgccccgcgccgacagc
cagcgtctctccaccgcggtgactgcggcgctcgactcatga

DBGET integrated database retrieval system