KEGG   Dinoroseobacter shibae: Dshi_3574Help
Entry
Dshi_3574         CDS       T00612                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dshi_3574 (cysQ)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dshi_3574 (cysQ)
Transfer RNA biogenesis [BR:dsh03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dshi_3574 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3764320..3765117
Genome map
AA seq 265 aa AA seqDB search
MDFETVMPVLRRLSLEAGDAIMEIYTSDDFDVRAKPDDSPVTAADEAADALISAGLKAAF
PDVLCVTEEQAASHSQAADSFFIVDPLDGTKEFVHRRGDFTVNIAYVENGTPVRGVVYAP
AKGRLFFTQADGTTVEETGDFDKDTVGTVKPLSVATPDNNALMVVASKSHRDQATDDYIG
KYGVKDMTSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAGHAVLLGAGGHVVRFDDHTP
LTYGKADYANPFFIAYAPGVDLKAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgagaccgtaatgcccgttttgcgccggctgtccctggaggccggggatgcc
atcatggagatctacacctccgacgatttcgacgtgcgcgccaagcccgatgacagcccc
gtcaccgccgccgacgaggccgccgatgcgctgatctccgcggggctgaaggcggccttt
cccgatgtgctctgcgtgaccgaggagcaggccgcctcccacagccaggccgcggacagc
ttcttcatcgtcgacccgctggacggtaccaaggaattcgtccatcgccgcggcgatttc
accgtcaacatcgcctatgtggaaaacggcacgcccgtgcgcggggtggtctacgcacct
gccaaggggcggttgttcttcacgcaggccgatggcaccacggtcgaagagaccggcgat
ttcgacaaggacaccgtcgggacggtcaaaccgctctcggtcgcgacgccggacaataat
gcgctgatggtggtggcctccaaatcccaccgggatcaggccactgacgactatatcggc
aagtacggggtcaaggacatgacctccgccggctcttcgctgaagttctgcctcgtggcg
acgggggaggcggatctctatccgcgcctcggccgcacgatggaatgggacaccgccgct
ggtcacgcggtgctgctgggcgcgggtggtcatgtcgtgcgattcgacgatcacacgccg
ctgacctatggcaaggccgactatgccaacccgttcttcatcgcctatgccccgggcgtg
gacctgaaggccgcctga

DBGET integrated database retrieval system