KEGG   Dinoroseobacter shibae: Dshi_3574Help
Entry
Dshi_3574         CDS       T00612                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dsh00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3764320..3765117
Genome map
AA seq 265 aa AA seqDB search
MDFETVMPVLRRLSLEAGDAIMEIYTSDDFDVRAKPDDSPVTAADEAADALISAGLKAAF
PDVLCVTEEQAASHSQAADSFFIVDPLDGTKEFVHRRGDFTVNIAYVENGTPVRGVVYAP
AKGRLFFTQADGTTVEETGDFDKDTVGTVKPLSVATPDNNALMVVASKSHRDQATDDYIG
KYGVKDMTSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAGHAVLLGAGGHVVRFDDHTP
LTYGKADYANPFFIAYAPGVDLKAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgagaccgtaatgcccgttttgcgccggctgtccctggaggccggggatgcc
atcatggagatctacacctccgacgatttcgacgtgcgcgccaagcccgatgacagcccc
gtcaccgccgccgacgaggccgccgatgcgctgatctccgcggggctgaaggcggccttt
cccgatgtgctctgcgtgaccgaggagcaggccgcctcccacagccaggccgcggacagc
ttcttcatcgtcgacccgctggacggtaccaaggaattcgtccatcgccgcggcgatttc
accgtcaacatcgcctatgtggaaaacggcacgcccgtgcgcggggtggtctacgcacct
gccaaggggcggttgttcttcacgcaggccgatggcaccacggtcgaagagaccggcgat
ttcgacaaggacaccgtcgggacggtcaaaccgctctcggtcgcgacgccggacaataat
gcgctgatggtggtggcctccaaatcccaccgggatcaggccactgacgactatatcggc
aagtacggggtcaaggacatgacctccgccggctcttcgctgaagttctgcctcgtggcg
acgggggaggcggatctctatccgcgcctcggccgcacgatggaatgggacaccgccgct
ggtcacgcggtgctgctgggcgcgggtggtcatgtcgtgcgattcgacgatcacacgccg
ctgacctatggcaaggccgactatgccaacccgttcttcatcgcctatgccccgggcgtg
gacctgaaggccgcctga

DBGET integrated database retrieval system