KEGG   Dinoroseobacter shibae: Dshi_4114Help
Entry
Dshi_4114         CDS       T00612                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dsh  Dinoroseobacter shibae
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dshi_4114
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dshi_4114
Enzymes [BR:dsh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dshi_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
pDSHI04:46419..46973
Genome map
AA seq 184 aa AA seqDB search
MQIEDTPLPGVKLLTPARFGDARGFFSESYSRRVLAGHGITLDFVQDNHSLSAQVGTVRG
LHFQAPPHAQDKLVRCGRGRLFDVAVDVRRGSPTYGQWFGAELSFENGKQLLVPAGFLHG
FVTREPDTEIVYKCSDYYAPECDGAVHWDSCGIDWGFEGDPVISAKDAAAVRLADFDSPF
VYEG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcgaagacaccccccttcccggcgtgaagctcctgaccccggcgcggttcggc
gatgcgcgggggttcttctccgaaagttactcgcgccgggtgctggccgggcatggcatc
acgctggatttcgtgcaggacaaccattcgctctcggcgcaggtgggcacggtccggggg
ttgcatttccaggcgcccccccatgcccaggacaagctcgtgcgctgcgggcgggggcgg
ctgttcgacgtggcggtggatgtgcgccggggcagcccgacctacgggcagtggttcggc
gccgagttgagtttcgagaacggcaagcagctgctggtgccggcggggttcctgcatggc
ttcgtcacccgggagcccgatacggagattgtctacaagtgcagcgactactatgcgccc
gagtgcgatggggccgtgcattgggacagttgcggcatcgactggggcttcgagggcgat
ccggtgatctccgccaaggatgccgccgccgtgcggctcgccgatttcgacagtccgttc
gtctacgagggataa

DBGET integrated database retrieval system