KEGG   Drosophila simulans: Dsimw501_GD10202Help
Entry
Dsimw501_GD10202  CDS       T01065                                 

Gene name
Dsim_GD10202
Definition
(RefSeq) GD10202 gene product from transcript GD10202-RE (EC:6.3.4.14)
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsimw501_GD10202 (Dsim_GD10202)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsimw501_GD10202 (Dsim_GD10202)
   00640 Propanoate metabolism
    Dsimw501_GD10202 (Dsim_GD10202)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dsimw501_GD10202 (Dsim_GD10202)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dsimw501_GD10202 (Dsim_GD10202)
Enzymes [BR:dsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dsimw501_GD10202 (Dsim_GD10202)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dsimw501_GD10202 (Dsim_GD10202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 2482 aa AA seqDB search
MLITILGTLAAFLAFLLTLIFGRGQKRSIPVQSSAATSATTATTGDSDNGNTNHNSSVIA
ATATATTTSSKPPIAPAAPPSAVKAGDKRFPKACIKKVQFSSESLRSDVEELCDQLKDSA
LSNLNNDNIRIACHQNNNNSSINKNQNNNSIDISISINKMSETNESNDTAAQTAEGDRPS
FLVGDEIDERAAEAGEACDEFPQKMQSDVRQNGDISERRKRLRPSMSRGTGLGQDRHQDR
DFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKL
PELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLKAQYSGKKIKISS
ELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPALFRQVQAEVPG
SPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFED
MEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPAAQLQ
IGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSS
GTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSI
RGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQ
ITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKE
IEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLI
NMIVEDGAHVSKGQAFAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDP
SLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEK
FMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASV
IDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYG
HYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLS
ELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLI
LSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLL
PTAHPNRLFSRMSSPDGLDQAAAESLGNSFVRTGAIAAFDSFEHFEMYSDEILDLLEDFV
SPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRE
TGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIY
RHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHS
DLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDPAKIE
ESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQT
EPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMT
ERHWREFSKARPTVDIRTPDKILIECKELVLEGDNLVEMQRLPGENNCGMVAWRIVLATP
EYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEE
VKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKD
DGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILT
GYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCD
LPIVLPSDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAK
TVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQA
IKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELR
GGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIGLKK
ELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVP
WRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGATEAYLWDKN
EEMVSWYEEQINAESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNR
GVVVRTLAQMQLNEETSNSNQG
NT seq 7449 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacgatattaggcactctggctgcttttctcgcattcctcttgacattgatc
tttggccgcggccagaaaagatccatacccgtccaatcgtctgcagcaacatccgccacg
acagcaacaactggcgacagcgacaacggcaacaccaatcacaactccagcgtgattgca
gctacagcaacagcaacaaccaccagcagcaagcctcccattgctccagcagcacctcct
tcggcggttaaggcgggtgacaagcgattccccaaggcgtgcatcaagaaggtccagttc
tccagcgagagcctccggtccgacgtggaggagctgtgcgaccagctgaaggatagcgca
ctcagcaacctaaacaacgacaacatccgcatcgcctgccaccagaacaacaacaacagc
agcatcaacaagaaccagaacaacaacagcatcgacatcagcatcagcatcaacaagatg
agcgaaacaaatgagtccaatgacacggccgcccaaaccgccgagggcgaccgtcccagc
tttttggtgggcgatgagatcgacgagcgggccgccgaggcgggcgaggcctgcgacgag
ttcccccagaagatgcagagcgatgtccgccagaatggggatatttccgagcggcgcaag
cggttaaggccgagtatgtcgcgtggcacagggctgggccaggaccggcaccaggatcgc
gactttcacatcgccaccaccgaggagttcgtgaagcgcttcggcggcacccgagtgatc
aacaaggtcctgattgccaacaacggtatcgcggccgtcaagtgcatgcgatccatccgg
agatgggcgtacgaaatgttcaagaacgagcgagccatcaggtttgtggtgatggtcact
ccggaggatctgaaggcgaacgccgaatacattaagatggcggatcactatgtgcccgtg
cccggcggatcgaacaacaataactacgccaatgtcgagctcatcgtggacattgctctt
cgcacccaagtgcaggccgtgtgggctggttggggtcatgcctccgagaacccgaagctg
ccggagctgctccacaaagagggtctggtgttccttggccctccggaacgtgccatgtgg
gcccttggcgacaaggtggcctcctcgattgtggcccaaactgccgaaatccccaccctg
ccgtggtccggatcggacctgaaggcccagtacagtggcaagaagatcaaaatttccagt
gagctcttcgcccgcggttgtgtgaccaatgtggaacagggtctggccgctgttaacaag
attggcttccccgtaatgatcaaggcctcggaaggaggtggtggcaagggtattcgccgc
gtggacaccactgaggagttccccgccctgttccgccaggttcaagctgaggtgcccggc
tcaccgattttcgtgatgaagctggcacgcggagcccgccacttggaggtgcaactgctg
gcggatcagtacggcaatgccattagcttgttcggccgtgactgctccatccagcgtcgt
catcagaaaattattgaggaagctcctgccatcgtggcccagccagaggtgttcgaggac
atggagaaggccgcggtgcggctggccaagatggtgggttacgtcagcgcgggaaccgta
gagtatctatatgatccggagggtcgctacttcttcctggagctgaacccccgtctgcag
gtggagcatccgtgtacggagatggtggccgatgtgaatcttcccgctgctcagctgcag
attggaatgggaattcccctttaccgactcaaggacatccgtctgctgtacggagagtct
ccgtggggctcgtcagtcattgacttcgaaaatccaccgaacaaaccgcgtccctccgga
catgttatcgctgcacgtatcacctcggagaaccccgacgagggctttaagcccagttct
ggaaccgttcaggagcttaacttccgctcgagcaaaaatgtgtggggctacttcagtgtg
gctgccagtggaggattgcacgagttcgcggactcacagtttgggcattgtttctcctgg
ggcgagaaccgtcagcaggctcgagagaacctggtgattgccctgaaggagctgtccatt
cgaggtgatttccgaaccacggtggagtacctgatcactctgctggaaacgaatcggttc
ctcgacaacagcatcgacaccgcctggctagatgccttgatcgcagagcgtgtgcaatcc
gagaagcctgatatcctgttgggcgtaatgtgcggatcgctgcacatcgcagatcgtcaa
atcactgagagcttctccagcttccagacctctctggagaaaggtcagatccaagcagcg
aacacgctgacgaacgtggtggatgtggagcttatcaacgatggcatccgttacaaggtg
caggccgccaagagcggagccaactcctacttcctgctgatgaacagctcgttcaaggag
atcgaggtgcaccgcctctctgacggaggtttgctcatctctttggagggcgcctcctac
accacgtacatgaaggaggaggtggatcgctaccgcattgtgattggcaaccagacatgt
gtcttcgaaaaggagaacgatccttcgctgctgcgcagcccctctgcgggaaagctcatc
aacatgattgtggaagatggcgcacatgtaagcaagggccaggcctttgctgagattgag
gtgatgaagatggtgatgaccctgacgtcccaggaggcaggcacagtgacatttgtgcgt
cgaccaggagctgttctagatgctggatcccttttgggccacttggagctggacgatcca
tcgctggtgacgaaagcacagcccttcaagggtcagttcctgcagccagagaatgcaccg
gtgcccgagaaactgaatagggtgcacaacacttacaagagcatccttgaaaacacactg
gctggttactgcctgccggaacctttcaatgcgcagagactgagagacattatcgagaaa
ttcatgcaaagcttgcgggatccctcgttgccgctgttggagctgcaagaagttatcgcc
tccatctcaggtcgcatacccatatccgtggagaagaagatccggaaactgatgacgctg
tacgagagaaacataactagtgtgctagcccaattcccctcgcagcagatcgccagtgtt
attgacagccatgcggccacgctgcagaagcgcgctgaccgtgatgtcttcttcctgacc
acccagagcattgtgcagctggtgcagcgctacaggaacggaatccgcggcagaatgaag
gccgccgttcatgagctactgcgtcaatactacgatgtggagtctcagttccagtatgga
cactacgacaaatgcgtgggactggtgcgcgagcacaacaaggacgacatgcagacggtg
gtcaacaccatcttctcgcactctcaggtggccaagaagaatctgctggtcactctgctc
attgatcacctgtgggccaacgaacctggactaacggacgaattggccaacacgctgagt
gaattgacctctttgaatcgagctgagcactctagggttgctctgcggtcccgccaagtt
ctgatcgctgcccaccagccggcctatgagctgcgccacaaccaaatggagtcgatcttc
ctctccgccgttgacatgtacggtcatgacttccaccccgagaacctgcagcgcttgatt
ctgtcggagacctcaatctttgacatcctacacgacttcttctaccactctaaccgggca
gtgtgcaatgctgctctggaagtctatgtaaggagagcttacacatcctacgagctgacc
tgcttgcagcatttggaactctccggtggcctgccgctggtgcacttccagttcctcctc
cccacagctcacccgaacaggctgttctcgcgcatgtcctcccccgatggattggatcag
gcagcggcagagtccttgggaaactcattcgtgcgcaccggagcgatagcagcctttgac
tccttcgaacactttgagatgtactcggacgagattctggatctgctcgaagacttcgtc
tcgccagccatggttaatgccaaggtcctggaagccgtagaggcagcggattccatctcg
gacagccgacacagcacctcgatcaatgtgtcgttgtcggatcccgtaacccgggcgaat
gctgccgaggaggccaagtccaccgaaccgattcacattgttagtgtggctgtgagagaa
acgggcgagttggatgacctgcaaatggcccagatctttggaaattattgccaagagcat
aacgaggagctcttccagcgacgcattcgtaggattacatttgctgctctgaagaagcga
caattccccaagttcttcacgttcagagccagggataaattcacggaggatcgtatttac
cggcatctggagccagcatctgctttccatctggagctgaaccgcatgaagacgtacgat
ctggaggctctgcccacggctaaccagaagatgcacctgtaccttggcaaggccaaggtg
tcgaaaggtcaagaggttacggactaccgtttcttcattcgctcgatcatccgtcattcg
gatctgatcaccaaggaagcctctttcgagtatctgcaaaacgaaggagagcgcgtgctc
ctggaggccatggatgagctggaggtggcattctcgcatccgcacgccaagcgcaccgac
tgcaaccacatcttcctgaactttgtgcccaccgtcatcatggatccggctaagatcgag
gagtctgtgacaaagatgattatgcgatatggtccgcgtctgtggaagctgcgtgtactg
caggctgagctcaagatggtcatccgccagtcgccacagtcacccactcaggcagtgcgt
ctgtgcattgcaaatgactccggctacttcctggatatttcgatgtacaccgagcaaaca
gaaccagagacaggaatcattaagttcaaggcctacggtgagaagcagggatctctgcat
ggacatcccatttccacgccctacatgaccaaggacttcctgcagcagaaacgtttccag
gcgcagtccaacggtaccacctatgtctatgatgtgcccgacatgttccgccagatgacc
gagcgtcactggagagaattctccaaggctcgtcccaccgtggacattcgcactccggac
aagattttgatcgagtgcaaggagctggtcctcgagggcgacaaccttgtagagatgcag
cgtctgcccggcgagaacaattgcggcatggttgcctggcgcattgtcttggctactccc
gaatatccgaatggccgtgagatcattgttatagccaacgatctcacctacttgattggt
tcctttggaattaaggaggacgttctgtttgccaaggcttcccaattggctcgccaactc
aaagtaccgaggatatacatctccgtgaacagcggtgcccgcatcggacttgctgaggag
gttaaagctatgttcaagatcgcatgggaggatccagaagagccagataagggtttcaag
tacctttacttgagcaccgaggactatgctcaggtggccaacctgaactcggtgagggct
atcctgatcgaggacgagggcgagcagcgttacaagattaccgacatcatcggcaaggac
gatggcctgggcgtggagaacctgcgctacgccggcttgattgccggtgaaacgtcgcag
gcctacgaggagattgttaccattgctatggttacctgccgcactattggcattggatcc
tatgtggtgcgcctgggtcagcgcgttatccagatcgataattcgcacattatactcact
ggctatgctgcgctcaacaagcttcttggacgcaaggtgtatgcctctaataatcagttg
ggtggcacacagatcatgtttaacaacggagtcacccacaaaacagaggccatcgacttg
gacggtgtctacaccatcctcgactggctctcgtacatccccgcgtacatcggttgtgac
cttcccatcgttttgcccagcgatcgcatcgaacgccctgtggacttcatgcccaccaag
tcgccctacgatccgcgctggatgctgggcggccgtgtaaatcccgtgaacgcgaatgac
tgggagaacggattctttgatcgggactcgtggagcgaaatcatggcctcgtgggccaag
acagtggtcactggtcgcgcccgtctaggcggtgtccccgtgggcgtaatagccgttgag
acccgcactgtagaagtggagatgcccgccgatcctgccaatctcgattcggaagccaag
accctgcagcaggcaggtcaggtgtggtaccccgactcctcgtacaaaacagcacaagca
atcaaagattttggacgagaggagttgccgctgattgttttcgcaaactggcgaggcttc
tccggcggcatgaaggacatgtacgagcaaatcgtcaagttcggagcatacattgtcgac
ggcctgcgggagtacaagaagcctgtgctcatctatctgccgcccaacgccgagctgcga
ggtggagcctgggctgtgctggattccctcattaacccgcgctacatggaaacgtatgcc
gatccggaggccagaggaggagttctcgagccggagggtattgtggaaataaagtacaaa
gagaaggatctggtcaagacgattcaccgcttggatccgaccaccattgggctgaaaaag
gagctcgatgaggcaaatgcgtctggcgacaaggtcagggctgctcaggtggacgaaaag
atcaaggcccgcatcgctgtgcttatgcacgtctaccacacggtagcagttcactttgcc
gacctgcacgacacgccggagcgaatgctagagaaggagtgtatcagtgagattgtgcct
tggcgcgattcccgccgctggctgtactggcgtctgcgacgtctgctgttggaggacgcg
tatattaagaagattctgcgcgctcaggacaacctctccgtgggtcaggccaagcagatg
ctgcgtcgctggctggtagaggagaagggtgccacagaggcttatctgtgggacaaaaac
gaggaaatggtgtcttggtatgaggagcagatcaatgccgaatctattgtttcccgcaac
gtgaactccgtgagacgggatgccattatttctaccatttcgaaaatgctcgaggactgt
cccgacgtagcgctggacgctgtagtgggtctttgccaaggtctgacgcctgtgaatcgt
ggcgtggtcgtacgcacattagcccagatgcagctgaatgaggagacctctaacagcaac
cagggatga

DBGET integrated database retrieval system