KEGG   Drosophila simulans: Dsim_GD10655Help
Entry
Dsim_GD10655      CDS       T01065                                 

Definition
GD10655 gene product from transcript GD10655-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dsim_GD10655
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dsim_GD10655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 564 aa AA seqDB search
MRLFPVRFSAASSSMASLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGG
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDVVRDAYENARFLCDQYYL
TSPALEIQQHSSEPGDNLPIRTVYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLK
VAICKGKEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPIS
RLYARYFHGDIVLLSCEGFGTDAIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSN
QSSDMNARQLSATTPKRCDFLQDA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtttccagtccgattctcagccgcctcctcgtcgatggcgagtttggccaaa
atgctcgacttttactcgggcttcaacccctcgcccctctcgataaagcagttcatggac
tttggtcagaatgcctgcgagaagaaatcgtacatattcctgcgcaaggagctgcctgtt
cgactggcgaatatcatgaaggagatcgcccttctgccggacaacctgctgcacaccaga
tccgtaagcgaagttagttcctggtacgtcaaaagtttcgaggatgtgctggtgtacgag
aaagcagagcccacccacgacaatctgcaaaagtttgtggccgatttggatctcattaga
aatcggcacaatgatgtggtgcaaacgatggcccagggtgtgatcgaaatgaaggagaac
gagggcggccaggtggatgcgcccacagagagttccattcagtactttctcgacaggctc
tacatgtctcgaatcagcattagaatgctgataaatcagcacacccttctctttggcgga
aannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntc
tcggatgtggttcgcgatgcctacgagaatgcgcgattcctgtgcgatcagtactacctg
accagtccggcgctggagatccagcagcacagcagcgagcctggagacaacctgcccatc
cgcaccgtgtacgtgccctcgcacctgtactacatgcttttcgagctcttcaagaactct
atgcgtgctgttgtggagcaccatggccatgacaacaatgacacattgccccccttgaaa
gtagccatctgcaagggcaaggaggacatctgcgtgaaaatttctgaccagggcggcggc
attccccgctcccagaccgatcagctcttcaagtatatgtacagcacagcgccgcagccc
tcgaagtcggatctgcatacggtgccactagcgggctatggatacggtctgccgatctca
aggctttacgcccgctatttccacggcgacattgtgctgctctcctgcgagggattcggc
accgatgcaattatctatctaaaggctctgtctgacgaagcaaacgaattgctgccgatc
ttcaacaagacaagctcaaagttctatcgcgccaccgtgcccacgggtgactggtcgaat
cagagctccgatatgaacgcacgccagttgtcggccaccacacccaagcgctgcgacttc
cttcaggacgcatga

DBGET integrated database retrieval system