KEGG   Drosophila simulans: Dsim_GD10704Help
Entry
Dsim_GD10704      CDS       T01065                                 

Definition
GD10704 gene product from transcript GD10704-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dsi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 236 aa AA seqDB search
MADDWESAADSDVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQALREEEAEAERLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPETKEEFKEFGATLSWKVAQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEVLHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgatgtggtcatccggccgactgccgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gatgaggaggaaaaaaaggacgaggagaagcccacgaaaacagaagcaccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgctccgagaggaggaagcg
gaggcagaacgtctggccaatctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgcccaggaagcgttcggcgtgacgagt
acgtgcggagggctcgacgccttcaaccccgagaccaaggaggagttcaaggagttcggc
gcaacgctcagctggaaggtggcgcagttccgcgagtctgagcacttcccccagtttgtt
gaggatctggtgcgcagcctatgcgtgaatctaagcgccgctgacatcaaaaaggtcaag
atgaacgtggaggtcttgcactcggaaaagctgaagctggaaaaggccaatgccaaaaag
cccgctggaaagggcaagggcaaggttactctccgcaccgaaaacgacgacattgacggt
taccaaaagtacggaaatgacttcaccgaagactatgacgacttcatgtga

DBGET integrated database retrieval system