KEGG   Drosophila simulans: Dsimw501_GD10704Help
Entry
Dsimw501_GD10704  CDS       T01065                                 

Gene name
Dsim_GD10704
Definition
(RefSeq) GD10704 gene product from transcript GD10704-RA
  KO
K03245  
translation initiation factor 3 subunit J
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD10704 (Dsim_GD10704)
Ribosome biogenesis [BR:dsi03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    Dsimw501_GD10704 (Dsim_GD10704)
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dsimw501_GD10704 (Dsim_GD10704)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 236 aa AA seqDB search
MADDWESAADSDVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQALREEEAEAERLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPETKEEFKEFGATLSWKVAQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEVLHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgatgtggtcatccggccgactgccgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gatgaggaggaaaaaaaggacgaggagaagcccacgaaaacagaagcaccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgctccgagaggaggaagcg
gaggcagaacgtctggccaatctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgcccaggaagcgttcggcgtgacgagt
acgtgcggagggctcgacgccttcaaccccgagaccaaggaggagttcaaggagttcggc
gcaacgctcagctggaaggtggcgcagttccgcgagtctgagcacttcccccagtttgtt
gaggatctggtgcgcagcctatgcgtgaatctaagcgccgctgacatcaaaaaggtcaag
atgaacgtggaggtcttgcactcggaaaagctgaagctggaaaaggccaatgccaaaaag
cccgctggaaagggcaagggcaaggttactctccgcaccgaaaacgacgacattgacggt
taccaaaagtacggaaatgacttcaccgaagactatgacgacttcatgtga

DBGET integrated database retrieval system