KEGG   Drosophila simulans: Dsimw501_GD10715Help
Entry
Dsimw501_GD10715  CDS       T01065                                 

Gene name
Dsim_GD10715
Definition
(RefSeq) GD10715 gene product from transcript GD10715-RC (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsimw501_GD10715 (Dsim_GD10715)
   01230 Biosynthesis of amino acids
    Dsimw501_GD10715 (Dsim_GD10715)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD10715 (Dsim_GD10715)
   00030 Pentose phosphate pathway
    Dsimw501_GD10715 (Dsim_GD10715)
   00051 Fructose and mannose metabolism
    Dsimw501_GD10715 (Dsim_GD10715)
   00052 Galactose metabolism
    Dsimw501_GD10715 (Dsim_GD10715)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dsimw501_GD10715 (Dsim_GD10715)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dsimw501_GD10715 (Dsim_GD10715)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsimw501_GD10715 (Dsim_GD10715)
Messenger RNA biogenesis [BR:dsi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dsimw501_GD10715 (Dsim_GD10715)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2R
AA seq 950 aa AA seqDB search
MHSIKFRVFTKLKPLFLEINGRIPKCRHFHGPSTFRLEISNKTPPIRQKLTFPNIGIQCT
RSLHLCCPRDISGSTLLSVKFNCKRHVIKLRSDSGDKKNDSPGDKNKKNDKSAQRCGKPI
NNLHSGFLNAENYSEKNVMKKKKRAPKKKCGKTVDELRKCLRTMQDVIDFVHPVKPFKDK
GLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSI
IHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLL
DELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTA
YSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQR
LNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRM
GAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGR
SFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYR
GDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFK
IQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEI
TEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDV
YHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPT
PFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIA
ETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaataaaatttcgagtatttaccaaattaaaacccttatttttggaaataaat
ggacggatacctaaatgccgccattttcatgggccttcaacatttcgattagaaatctca
aacaaaacacctccgattaggcaaaagctcacatttccaaacatcggcatccaatgcaca
cgaagtcttcatttgtgttgtcctcgagatatttcaggaagtactcttttaagtgtaaaa
tttaattgcaaacgacatgttataaagttgcgcagtgattctggtgataaaaagaatgac
agtcctggtgataaaaacaaaaagaatgacaagtctgcgcaacgatgtggaaaaccaata
aacaatctgcacagcggatttctcaatgctgagaactattctgaaaaaaatgttatgaaa
aagaaaaagcgtgctccaaaaaagaaatgtggcaaaacggtggatgagctgcgaaagtgt
ttaagaaccatgcaggatgttattgattttgtacatccagtcaagccttttaaggacaaa
ggactggcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtgcgagcc
tgtgtgcgtatggccatctatttgggctgcaaggtctacttcatccgtgaaggctaccag
ggcatggtggatggaggcgactgcatccaggaagccaactgggcctcagtctcatccatt
atccatcgcggtggcaccatcattggctccgcccgttgccaggacttccgtgagcgtcag
ggtcgcttgaaagccgctaacaacctgattcagcgaggaatcaccaatctggtggtcatt
ggaggcgatggctccctcacgggcgccaatctgttccgtcaggagtggtccagcctgctg
gacgagctggtcaagaacaagaccattaccaccgagcagcaggagaagttcaatgtcctg
cacatcgttggattggtgggctccatcgacaacgatttttgcggcacggacatgaccatc
ggcacggatacggcactgcatcgcatcatcgaggccatcgatgccatctccagtaccgcc
tactcccatcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatttagct
cttgtgggcggactggcgtgcgaggcggatttcatattcattcccgaaatgccgcccaag
gtcgattggccagacaggctctgctcacagctggcccaggagcgatctgctggccagcgt
ctgaacatcgtgatcgtggccgagggagccatggatcgcgagggtcatcccatcacagcc
gaggatgtaaagaaggtgatcgacgagcgtctgaagcacgatgcccgcatcactgtcttg
ggtcacgtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgccgcatg
ggagctgaggccactttggccctgatggaggccaccaaggactcggtgccagtggtcatc
tctctggacggcaaccaggcggttcgcgttccgctgatggagtgcgtggagcgcacccag
gctgtggccaaagccatggcggagaaacgctgggcggatgccgtcaaactgcgcggacgc
tccttcgagcggaatctggagacctacaagatgctgacgcgcttgaagccgcccaaggag
aacttcgacgccgatggcaagggaatcgagggttaccgcctagctgtgatgcacattggt
gctccggcttgcggtatgaatgccgctgtgcgcagcttcgtgcgcaatgccatctaccgc
ggtgatgtggtatatggaatcaacgacggtgtcgagggcctgattgccggaaatgtccgc
gagctgggctggtccgatgtctcaggatgggttggtcagggtggcgcctacttgggcact
aaacgcacactgcctgagggcaagttcaaggagatcgctgctcgtctcaaggagttcaag
atccagggtctcctgatcatcggtggctttgagagttaccatgccgccggacagatcgcc
gatcagcgggacaactacccgcagttctgcatccccattgtggttattccatcgacgatc
tcgaacaatgtgcccggcacagagttttcactgggatgtgacaccggtttaaatgagatt
acggagatttgcgaccgtatccgtcagtccgcccagggcaccaagcgccgagtgttcgtc
atcgagacgatgggtggctactgtggctatttggccacactggccggtttggccggtgga
gctgatgccgcctacatctacgaggagaagttctccatcaaggacctgcagcaggatgtc
taccacatggcctccaagatggccgagggcgtctcccgcggtctgatcctgcgaaacgag
aaggctagcgagaactacagcacggacttcatttaccgcctgtactcggaggagggcaag
ggcctcttcacctgccggatgaacatcctgggccacatgcagcagggcggctcacccact
cccttcgaccgcaacatgggcaccaaaatggccgctaagtgtgtcgactggctggccacc
cagatcaaggcgaacatagacgccaacggagtggtcaactgcaagtccccggacaccgcc
acgctgctgggaatcgtgtcgcggcagtaccgcttctcaccactggtcgacctcattgcc
gagacgaacttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctg
ctgcgcatcctggccaagcacgattccgcctacgaggaggagggtatgtacatcaccgtc
gaggaggagtgtgacaccgacgccgtcgcctaa

DBGET integrated database retrieval system