KEGG   Drosophila simulans: Dsim_GD10715Help
Entry
Dsim_GD10715      CDS       T01065                                 

Definition
GD10715 gene product from transcript GD10715-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD10715
   01230 Biosynthesis of amino acids
    Dsim_GD10715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD10715
   00030 Pentose phosphate pathway
    Dsim_GD10715
   00051 Fructose and mannose metabolism
    Dsim_GD10715
   00052 Galactose metabolism
    Dsim_GD10715
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dsim_GD10715
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsim_GD10715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 607 aa AA seqDB search
MALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPVSVNW
KDEICVKLHQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHV
QRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVA
KAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPA
CGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRT
LPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNN
VPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADA
AYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLF
TCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATLL
GIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEE
CDTDAVA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcatcgcatcatcgaggccatcgatgccatctccagtaccgcctactcccat
cagcgcaccttcatcatggaggtcatgggtcgtcattgcggttacttagccatatcggca
gccatagccacagaggctgattttatgttcatacccgaggagccggtgtcagtcaattgg
aaggacgagatctgtgtcaagctccaccaggagcgatctgctggccagcgtctgaacatc
gtgatcgtggccgagggagccatggatcgcgagggtcatcccatcacagccgaggatgta
aagaaggtgatcgacgagcgtctgaagcacgatgcccgcatcactgtcttgggtcacgtg
cagcgcggtggcaatcccagtgccttcgatcgtattttggcttgccgcatgggagctgag
gccactttggccctgatggaggccaccaaggactcggtgccagtggtcatctctctggac
ggcaaccaggcggttcgcgttccgctgatggagtgcgtggagcgcacccaggctgtggcc
aaagccatggcggagaaacgctgggcggatgccgtcaaactgcgcggacgctccttcgag
cggaatctggagacctacaagatgctgacgcgcttgaagccgcccaaggagaacttcgac
gccgatggcaagggaatcgagggttaccgcctagctgtgatgcacattggtgctccggct
tgcggtatgaatgccgctgtgcgcagcttcgtgcgcaatgccatctaccgcggtgatgtg
gtatatggaatcaacgacggtgtcgagggcctgattgccggaaatgtccgcgagctgggc
tggtccgatgtctcaggatgggttggtcagggtggcgcctacttgggcactaaacgcaca
ctgcctgagggcaagttcaaggagatcgctgctcgtctcaaggagttcaagatccagggt
ctcctgatcatcggtggctttgagagttaccatgccgccggacagatcgccgatcagcgg
gacaactacccgcagttctgcatccccattgtggttattccatcgacgatctcgaacaat
gtgcccggcacagagttttcactgggatgtgacaccggtttaaatgagattacggagatt
tgcgaccgtatccgtcagtccgcccagggcaccaagcgccgagtgttcgtcatcgagacg
atgggtggctactgtggctatttggccacactggccggtttggccggtggagctgatgcc
gcctacatctacgaggagaagttctccatcaaggacctgcagcaggatgtctaccacatg
gcctccaagatggccgagggcgtctcccgcggtctgatcctgcgaaacgagaaggctagc
gagaactacagcacggacttcatttaccgcctgtactcggaggagggcaagggcctcttc
acctgccggatgaacatcctgggccacatgcagcagggcggctcacccactcccttcgac
cgcaacatgggcaccaaaatggccgctaagtgtgtcgactggctggccacccagatcaag
gcgaacatagacgccaacggagtggtcaactgcaagtccccggacaccgccacgctgctg
ggaatcgtgtcgcggcagtaccgcttctcaccactggtcgacctcattgccgagacgaac
ttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctgctgcgcatc
ctggccaagcacgattccgcctacgaggaggagggtatgtacatcaccgtcgaggaggag
tgtgacaccgacgccgtcgcctaa

DBGET integrated database retrieval system