KEGG   Drosophila simulans: Dsim_GD10945Help
Entry
Dsim_GD10945      CDS       T01065                                 

Definition
GD10945 gene product from transcript GD10945-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dsi  Drosophila simulans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsim_GD10945
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dsim_GD10945
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsim_GD10945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 685 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLEDWLNKINQSEGGLDGFSTAYKHYGLHFQ
PDNSVIAREWAPGARDVYLTGDFNNWHWESHPFKKLDFGKWELHLPPNEDGSPAIKHLSE
IKIIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHPGPPRPK
SLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTS
FYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGA
RGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSG
DYNEYFGLNVDTDALNYLGLANHLLHTLDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTMSDPSLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNETEERYGWLHSGPAWVSWKHEGDKIIA
FERAGLVFVFNFHPQQSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEG
YAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcacgagatccgtcgtcgtcatggcgtgctcgaggattggctgaataagataaaccaa
agcgaaggcggactggatggcttttcgacggcttacaagcactacggacttcacttccag
ccggacaattcggtgattgcccgcgagtgggcacctggagccagagatgtctatctcacg
ggtgacttcaacaactggcactgggaatcgcatccgtttaaaaagctcgactttggcaag
tgggagctgcacctgccccccaacgaggacggcagtccggccatcaagcacttgagcgaa
attaagattatcattcgcaaccattccggtcaattgctggaccgcctgtcgccctgggcc
aagtacgtggtgcagccgcccaagtcggccaaccagggggtcaactacaagcagtacgtg
tgggagcctccgtcctacgagcgttaccaacgccagcatccgggtccgccaaggcccaaa
tcgctcaggatctacgagtgccacgtgggtatcgcctcccaggagccgcgggtcggcagc
tacgacgagttcgccgatcgcatcgtgccgcgcatcaagcgtcagggctataactgcatc
caggttatggccatcatggagcacgcctactacgccagtttcggctatcaagtgaccagc
ttctatgcggcctccagccgttatggcaacccggagcagctgaagcgcatgatcgacgtg
gcccactcgcacggccttttcgttctgctcgatgttgttcactcgcatgcttccaagaac
gttcaggacggtctgaaccagttcgatggcaccaacagttgcttcttccacgacggagct
cgtggcgagcactcgctgtgggacagtcgtctcttcaactacgttgagtacgaggtgctg
cgctttttgctatccaacttgcgttggtggcacgacgagtacaacttcgatggctatcgc
tttgacggagtaacctctatgctgtaccattcccgtggcattggggagggcttcagcggc
gactacaacgagtactttggcctgaacgtcgacacggatgccctcaattatctgggactg
gccaatcatctgctgcacaccttagattcgaggattatcaccattgcagaggatgtttct
ggaatgcctaccttgtgtcgccccgtatcagagggtggtatcggattcgactaccgcctg
ggaatggccatcccagacaagtggatcgaactgctgaaggagcagagtgacgatgagtgg
gacatgggcaacttggtgcacacgctgaccaaccgtcgctggatggagaacacagtggcc
tacgcagagtcccacgatcaagcgctagtgggcgacaagacaatcgccttctggctgatg
gacaaggagatgtatacgcacatgtcgacgatgtcggacccctcattgatcatcgaccga
ggactggcgctgcacaagatgattcggctgatcacgcacgccctgggaggcgaggcgtac
ctgaactttatgggcaacgagttcggacatcccgaatggctggactttccgcgcgttggc
aacaacgattcgtatcactatgctcgtcggcagtggaatctcgtggacgacgatctgctg
aagtacaagtacctcaacgaattcgatcgagccatgaacgagaccgaggagcgctacggc
tggctgcattccggacccgcttgggttagctggaagcacgagggcgacaagatcatcgca
ttcgagcgtgccggtctggtgttcgtcttcaacttccatccccagcagagtttcaccgga
taccgtgtgggcaccaattgggcgggcacctaccaggcagtgctctcctcagacgatcct
ctcttcggcggccacaaccgcatcgatgccaactgcaaacatccctccaatccggagggc
tacgccggtcgctccaatttcattgaggtctacacaccctcacgcaccgccgtggtctat
gcccgcgtcagtgactag

DBGET integrated database retrieval system