KEGG   Drosophila simulans: Dsim_GD11207Help
Entry
Dsim_GD11207      CDS       T01065                                 

Definition
GD11207 gene product from transcript GD11207-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dsim_GD11207
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dsim_GD11207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 317 aa AA seqDB search
MSYVRQLKRQKMSQGKKFGDGDPFNYQELNIIGEGAYGTVYRARDVVTGNIVALKKVRIS
LNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDL
IDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQL
DRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLR
PSALACLEHDYFQQEPL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatgtacgccagctgaagcggcagaaaatgtcccaggggaagaagttcggcgat
ggcgatccgttcaactaccaggagctcaacatcatcggcgaaggtgcctatggaacggtt
tacagagcccgggatgtggtcaccggcaacatagtggcgctgaagaaggtgaggatatcg
ctgaacgagaacggagtgcccatgtccacgctgcgcgagatctcgctgctgaagcagctg
aatgccagcaatcatgcgaatattgttaaactgtacgaagtatgccagtttctggagcgc
gacggccaactgctgattctgctggttttcgagcatgtggagcaggatctgtcggatctt
atagacagacttcccaaatcgggcatgtcgccgcccacaattcagcgcttgtcgagggaa
ctactgaccggtgtggacttcttacactcacaccgcatcatccatcgggatctgaagccg
cagaacctgctggtctcctcgcagggccacctcaagatcgccgactttggcctggccaag
acctacggttcggagatgaagctcacctccgtggtggtcaccttgtggtaccgcgcaccc
gaggttctgctcgcccagccctacaacagcaccgtggacatctggagcgccgcctgcatc
atcttcgagatgttcaatcggcgcgccctgttcccgggcacctccgagaagaatcagctg
gaccgcatctttgaactgactggcagacccaccgagcaacaatggccacagaccatttcc
gtggccctggaacactttccccagcggcatccaaagagaccaaaagacttttgcccacac
ctgtgcaagtacgccgatgatctgttgaataaaatgctttcctacgacctccacttgcga
ccatccgccttggcctgtttggagcacgactacttccagcaggaacccctatag

DBGET integrated database retrieval system