KEGG   Drosophila simulans: Dsim_GD11284Help
Entry
Dsim_GD11284      CDS       T01065                                 

Definition
GD11284 gene product from transcript GD11284-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD11284
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dsim_GD11284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 690 aa AA seqDB search
MAKKKSEEHSGADANDSDYQEEPNFEDPPGFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPVRLEKLKSVINKLFSNYGDIVNVVYPVDEEGKTKGYAFMEYKQASQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTFKVQSDLYNFINDPDTYDQYC
VAAETAPNCVQVGFWQNVLPEPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKDLDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGETNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIITSSPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWADQKSRRIMLR
GHVDTDNLETDEVDEEIVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaaaagcgaggagcactccggtgcggatgcgaacgacagcgattaccag
gaggagccgaactttgaggatccgcccgggttcgtggacaacattagtgatgaagatctg
ctgggcgatatgctggcccagcgcccctcggaggccgatggcgtcgagagtgtggtggta
gtggacaacatcccgaaggtggagccggtgcgcctggagaagctgaagtcggtcatcaac
aagctgttttcgaactacggagacattgtcaatgtggtctaccccgtcgacgaggagggc
aagaccaagggctacgccttcatggagtacaagcaggctagccaggcggaggaggccgtc
aagaagctcaacaatcatcgcctagacaagaaccacacatttgccgtcaatcttttcacc
gatttccaaaagtatgaaaacatccccgagaagtgggagccgccaaccgtgcagaccttc
aaggtgcagagcgatctatacaacttcatcaacgacccggacacttatgaccagtactgc
gtggcagcggagactgcgcccaactgcgtgcaggttggtttctggcaaaacgtattgccc
gaaccctttgagctggagacccgcgagcgcttcaccgacaccttcgtcaagtggtcgccc
ttgggtacttatgtggtcaccttccacaaacccggcgtggccatctggggtggcagtagc
ttccagaagatccagaagttcccccatcctggtacccaattcgttgagttttcgccctgc
gagaattaccttgtgacctacgggcccacacccacgggccaaaagatcatcatctgggac
attcgcacaggagccgagaagcgttcgtttgttgccgatggcatgtcggttctttccatg
ttccgctggtcgcacgacgacaagtttgtggcccgcatgggtgagaattcgatccacatc
tacgagacaccctctttctatcttctggacctgaagtccatcaagattcccggcattcgc
ggcttctcgtggtcccccacagacaacgtgatcgcctactgggtggaggagcagaaccaa
atacccgcccgcgttaccctgatggagatccccaagaagcgtgagatccgtaacaagaac
ctcttccatgtggccgactgcaagcttcattggcaaaagtccggcgactatctgtgcgtt
aaggtggatcgctactcaaagttgaagaaggacaagaaggacctggacgtcaagtttctg
ggcatgttctacaactttgagatcttccacatgcgcgagaaggagattcccgtcgactct
gtggagattcgcgagctcattctggcctttgcctgggagcccatcggcaacaagttctcc
atcattcacggcgagaccaactcgtcgaatgtgagcttctacgaggtgaacaagggtgtg
aagcccagcttggtgaagcgtctggaaaagaagtcctgcacgcatctgttctggtcgcca
cgcggtcagttcatcgtgatggccaacctcaccatgggtaccttcgagtttgtggactcc
accaacgattacatcatcacgtcgtcgcccgatcatttccgcgcctccgaggtcgagtgg
gatcccactggacgctacgttgtgactggtgtctcgtcatggaaggtgaaggaggacacc
ggcttcaacatgtacacgttccagggccgcatcatcaagcgtaccatcctcaagaacttt
gtgcagttcttgtggcgcccgcgtcctcccaccctgctcagcgaagagaagcagaaggag
atcaagaagaacttgaagaagtactacgctgccttcgaacaaaaggatcgcctgcgcctt
acccgtgcctccaaggagctgctcgagaaacgctcgcagctgcgcgagacctttatggag
taccgcaacaagcgtatcgccgagtgggcggaccagaagagtcgtcgcatcatgctgcga
gggcatgtggacacagacaacctggaaactgacgaagtggatgaagaaattgttgaattt
ttagtcaaggaagaagtcactctgctggagtag

DBGET integrated database retrieval system