KEGG   Drosophila simulans: Dsim_GD11572Help
Entry
Dsim_GD11572      CDS       T01065                                 

Definition
GD11572 gene product from transcript GD11572-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dsi  Drosophila simulans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsim_GD11572
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dsim_GD11572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 273 aa AA seqDB search
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKSSQQLKLDMLNLE
LASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERA
AKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLP
CNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGV
QKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaaacggcagtggccaaaatggcgagggagccgcggat
gccgtggccgttgccacgatccccacgggcgaagcctccgccgcctccgccacgtccggc
accgatctaacggtctccaaaagcagccagcagctgaaactggacatgctcaacttggag
ctggccagcaatggaagcggccacgagaagtgcacgttccaccacgacctggagctggac
cacaagccgccgacgcgggaggcccttctcccggacatggcacgctcgtatcgcctactc
ttgggcggcctgggcgagaatcccgatcgccagggactgatcaagacgccggagcgggcg
gccaaggccatgctgtacttcaccaagggctacgaccagagtctcgaggatgttctcaat
ggcgccgttttcgacgaggatcatgacgaaatggtggtggtcaaggacattgaaatgttc
tccatgtgcgagcatcatctggtgcccttctacggcaaagtttccatcggctacttgccg
tgcaacaagattctcggactcagtaaattggcacgcattgtcgaaatattttcgcgtcgc
ctgcaagtccaggagcgcttgaccaagcagatcgcagtggccgtgactcaggccgtgcaa
cccgctggagtggcagtggtcgtagagggagtccacatgtgcatggtgatgcgtggcgtg
cagaagatcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatccc
aagacccgtgaggaattcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system