KEGG   Drosophila simulans: Dsim_GD12130Help
Entry
Dsim_GD12130      CDS       T01065                                 

Definition
GD12130 gene product from transcript GD12130-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD12130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD12130
   00620 Pyruvate metabolism
    Dsim_GD12130
   00640 Propanoate metabolism
    Dsim_GD12130
Enzymes [BR:dsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dsim_GD12130
Lipid biosynthesis proteins [BR:dsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dsim_GD12130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 674 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADPEKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKEMGHSVKKCIVVSHLKRVTPCPLDHVEEEIPWT
DDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFK
IVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYK
VTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIV
DTFWQTETGGHVITPLPGATPMKPGSASSPFFGVKPTLLDECGIEIKGEGEGYLVFSQPW
PGNDAPLYNNHETFRGHLLLQVPQASTALARVSHEVWTAFHCDFKRARRDADGYLWITGR
VDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKL
ISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQ
IVEQLFANRPVEAK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatatacgatcccaacccggccatcagccaaaatgcctacata
tccagcttcgaggagtaccagaagttctaccaggagtcgctggacaacccagccgagttc
tggtcccgcgtggccaagcagttccattgggaaacgcccgcagatccggagaagttcctc
aagtacaacttcaacatctccaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctcctagatcgcaacgtaaggaacggcctgggcgaccagata
gcctactactgggagggcaaccaccccgacgattattcccgaggtcttacctatcgcaag
ttgctggaggaggtgtgccgcttcgccaacgtgctgaaggatcatggcattcgaaagggc
gatcgtgtatccatttacatgcccatgattctggagctgcccatcgcgatgctggcctgc
gcccgcattggagccgtgcactcgatcgttttcgccggattctcaccggactcgctggcg
gagcggatgttcgattgcaaggccaagctgctgattacggcggatggagcctggcgtgga
gagaaacccctgtacctgaaggagatgggacactccgtgaagaagtgcatcgtggtgtcg
cacttgaagcgcgtgactccgtgcccactggatcatgtcgaggaggaaatcccatggacc
gatgaccgcgattactggtggcacgaggagatggaggacaaggagccggcctgctatccc
gagtggatggacgccgaggatccgctgttcatgctctacaccagtggctccactggcaag
cccaagggagtgctccacacgacggccggatatctgctgtatgcggctacgaccttcaag
atcgtatttgactataagccaggggatatctactggtgcaccgccgatgttggctggatc
acgggacacacctacgtcgtgtacggaccattggccaatggggccacttcagtgattttc
gagggcacaccattcttccctggaaacgatcgttactggagtgtcattgacaaatataag
gtaacccagttctacacagctcccacggcgattcgtgccctcatgaagttcggagagggt
cccgttctgaagcacaacctgagcggactcaaagttttgggcagcgtgggtgagcccatc
aacccggaggcctggctctggtattacaagtacattggaaaggagcagtgctccattgtg
gacaccttttggcaaacggaaaccggtggtcatgtcattacacctctgcctggagcgact
cccatgaagccgggatctgcttcatcccctttctttggagtgaagcccactttgctggat
gagtgcggcattgaaattaagggggagggagagggctacttggtcttctcgcaaccttgg
cccgggaatgatgcgccgttgtataacaaccatgaaacgtttcgaggacacttacttctc
caagttccccaggctagtactgcactggcgagggtgagtcatgaagtttggactgctttt
cattgtgactttaaaagagcccgtcgcgatgctgatggctatttgtggatcactggccgt
gtagacgacatgttaaacgtgtccggtcatctaatgtccaccgccgaggttgagtcggtt
ctcacagagcatcctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaag
ggcgagtgtctctactgcttcattacgccgaacgagaacgaggtattcgaccagaaacta
atttcggacctgaagaagatggtgcgagaacgtatcggaccttttgccatgccggatgtc
attcaaaatgctcccggactgcccaaaactcgttccggcaagattatgcgtcgtgtgctg
cgcaagatcgcggttaacgatcgcaacgtgggcgacacatctaccttggccgatgagcaa
attgtggagcaactgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system