KEGG   Drosophila simulans: Dsimw501_GD12130Help
Entry
Dsimw501_GD12130  CDS       T01065                                 

Gene name
Dsim_GD12130
Definition
(RefSeq) GD12130 gene product from transcript GD12130-RB
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsimw501_GD12130 (Dsim_GD12130)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD12130 (Dsim_GD12130)
   00620 Pyruvate metabolism
    Dsimw501_GD12130 (Dsim_GD12130)
   00640 Propanoate metabolism
    Dsimw501_GD12130 (Dsim_GD12130)
Enzymes [BR:dsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dsimw501_GD12130 (Dsim_GD12130)
Lipid biosynthesis proteins [BR:dsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dsimw501_GD12130 (Dsim_GD12130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3L
AA seq 670 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADPEKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
KYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaaaaatcaatatacgatcccaacccggccatcagccaaaatgcctacata
tccagcttcgaggagtaccagaagttctaccaggagtcgctggacaacccagccgagttc
tggtcccgcgtggccaagcagttccattgggaaacgcccgcagatccggagaagttcctc
aagtacaacttcaacatctccaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctcctagatcgcaacgtaaggaacggcctgggcgaccagata
gcctactactgggagggcaaccaccccgacgattattcccgaggtcttacctatcgcaag
ttgctggaggaggtgtgccgcttcgccaacgtgctgaaggatcatggcattcgaaagggc
gatcgtgtatccatttacatgcccatgattctggagctgcccatcgcgatgctggcctgc
gcccgcattggagccgtgcactcgatcgttttcgccggattctcaccggactcgctggcg
gagcggatgttcgattgcaaggccaagctgctgattacggcggatggagcctggcgtgga
gagaaacccctgtacctgaaggctctgtgcgacacggccttggagaaggtcgaggagatg
ggacactccgtggagaagtgcatcgtggtgtcgcacttgaagcgcgtgactccgtgccag
ccggatcatgtcgaggaggaaatcccatggaccgatgaccgcgattactggtggcacgag
gagatggaggacaaggagccggcctgctatcccgagtggatggacgccgaggatccgctg
ttcatgctctacaccagtggctccactggcaagcccaagggagtgctccacacgaccgcc
ggatatctgctgtatgcggctacgaccttcaagatcgtatttgactataagccaggggat
atctactggtgcaccgccgatgttggctggatcacgggccacacctacgtcgtgtacgga
ccattggccaatggggccacttcagtgattttcgagggcacaccattcttccctggaaac
gatcgttactggagtgtcattgacaaatataaggtaacccagttctacacagctcccacg
gcgattcgtgccctgatgaagttcggcgagggtcccgttctgaagcacaacctgagcgga
ctcaaagttttgggcagcgtgggtgagcccatcaacccggaggcctggctctggtattac
aagtacattggaaaggagcagtgctccattgtggacaccttttggcaaacggaaaccggt
ggtcatgtcattacacctctgcctggagcgactcccatgaagccgggatctgcttcattc
cccttctttggagtgaagcccactttgctggatgagtgcggcattgaaattaagggggag
ggagagggctacttggtcttctcgcaaccttggccgggaatgatgcgcaccttgtataac
aaccatgaacgtttcgaggacacttacttctccaagttcccaggctactactgcactggc
gatggagcccgtcgcgatgctgatggctatttgtggatcactggccgtgtagacgacatg
ttaaacgtgtccggtcatctaatgtccaccgccgaggttgagtcggttctcacagagcat
cctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaagggcgagtgtctc
tactgcttcattacgccgaacgagaacgaggtattcgaccagaaactaatttcggacctg
aagaagatggtgcgagaacgtatcggaccttttgccatgccggatgtcattcaaaatgct
cccggactgcccaaaactcgttccggcaagattatgcgtcgtgtgctgcgcaagatcgcg
gttaacgatcgcaacgtgggcgacacatctaccttggccgatgagcaaattgtggagcaa
ctgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system