KEGG   Drosophila simulans: Dsim_GD12336Help
Entry
Dsim_GD12336      CDS       T01065                                 

Definition
GD12336 gene product from transcript GD12336-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsim_GD12336
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD12336
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dsim_GD12336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 496 aa AA seqDB search
MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACL
HCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKD
LQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTP
LLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGY
EQQDAHEFFIATLDVLHRHCVKAKAEHDSKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQ
IFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLG
SAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTP
FMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLD
SEGYLLFYHKNVLEYE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgggttgtcggcactatcaaagctatgtgaaggagcacagctacgataca
ttccgggtcatcgacgcctacttcgctgcctgcgtcaacagagatgcgcgcgagcgaaag
gctattcactgcaactgcttcgagtgcggcagctacggcatccagttgtacgcttgcctg
cactgcatttacttcggctgccggggggcccacatcacgagtcacctgcgatccaagaag
cacaatgtggccctggagctgtcccacggaacgctctactgctacgcctgcagggatttc
atctacgacgcgcggagccgcgagtatgcgctgatcaaccgcaagctggaggccaaggat
ctgcagaagagcatcggctgggtgccgtgggttcccacgaccaaggagaccaatctgctg
ctggccaatgcgaggcgtcggctggtgaggcccaatcaaacgatcggactgaggggtctg
cttaatctgggcgccacttgcttcatgaactgcatcgtccaggcgctggttcacacaccc
ctgcttagcgattacttcatgtcagatcgccacgactgcggcagcaagtcatcgcacaaa
tgtctcgtttgcgaagtgtcacgtctcttccaggagttctattccggctcccgttcgccg
ttgtcgctgcatcggctactgcatttaatctggaaccatgcgaagcacttggccggctac
gagcagcaggacgcgcatgagttcttcatcgccactctggacgtgctgcatcggcactgc
gtgaaggcaaaggcggagcacgacagcaagagcaacagctctggctcgggaagtggaact
aattccagcaactctagcagctcgcattgctacggccagtgtaattgcatcattgaccag
atcttcacgggcatgctgcagagcgatgtggtgtgccaggcgtgcaacggagtgtccacc
acgtacgatccgttttgggacatttcgctggacctgggcgaaacaacaacgcatggtggt
gttaccccaaaaacgctgatagactgcctggagcggtacactcgggccgagcatctcgga
tcggccgccaagatcaagtgctctacctgcaaatcctaccaggagtccaccaaacagttc
agcttgcgcacgctgcccagcgtggtgtccttccatctgaaacgcttcgagcactcagct
ctgatcgatcgcaagatctcctcgttcattcagttccccgtggagttcgacatgacgccc
tttatgtcggagaagaagaacgcctacggagacttccggttctctctgtacgccgtggtc
aatcatgtgggcaccatcgacaccggccactatacggcgtatgtgcggcaccagaaggac
acgtgggtcaagtgcgatgatcatgtgataacgatggcatcgctcaagcaggtgctggac
agcgagggttatttattgttctaccataaaaacgtgctggaatacgagtaa

DBGET integrated database retrieval system