KEGG   Drosophila simulans: Dsimw501_GD12336Help
Entry
Dsimw501_GD12336  CDS       T01065                                 

Gene name
Dsim_GD12336
Definition
(RefSeq) GD12336 gene product from transcript GD12336-RA (EC:3.4.19.12)
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD12336 (Dsim_GD12336)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsimw501_GD12336 (Dsim_GD12336)
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dsimw501_GD12336 (Dsim_GD12336)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dsimw501_GD12336 (Dsim_GD12336)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     Dsimw501_GD12336 (Dsim_GD12336)
    SLIK complex
     Dsimw501_GD12336 (Dsim_GD12336)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 734 aa AA seqDB search
MFQYSYIRKIPMPAFKYAFATGHTDSCLPPTHMRACVCVCVQCEIETRKASEKSQKFHKK
KPNXFENWAARRRTAKVAKIRRKQRKCDKAFVPLQSSAKRAKTKENSVDSNTSVFSSSSS
SSSGRSFGRGTERWAVGAEAGRGTAENETLAAAAAATTTNAGRFITADLIKTVNSDKQRD
RVAKGHRDAKNPLDATKHLRLSDCLRTVQKLAIELESADAGSDASAQAKASADASSAVMS
ETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACLHC
IYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKDLQ
KSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLL
SDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQ
QDAHEFFIATLDVLHRHCVKAKAEHDSKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIF
TGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSA
AKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFM
SEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSE
GYLLFYHKNVLEYE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatactcttatattagaaaaataccaatgccagcatttaagtacgctttcgca
actggtcacactgacagctgtcttccaccaacacatatgcgcgcgtgtgtatgtgtgtgc
gtgcagtgcgaaatagaaacaagaaaagcaagcgaaaaatcacagaaattccacaaaaaa
aagcccaactagttcgaaaattgggccgcccggcgaagaaccgcaaaagtggccaaaatt
cggcgaaaacagcgcaagtgtgacaaagcattcgtgccgctgcagtcgtcggcgaaacgg
gcgaaaacaaaagagaatagtgttgatagtaatacgagcgtatttagcagtagcagcagc
agcagcagtggccgaagcttcggcaggggaacggaacggtgggcggtgggtgcggaagcg
ggccggggaacggccgagaacgaaacattagcagcagcagcagcagcgacaacaacaaat
gccggtcgctttatcaccgccgatctaatcaaaacagttaacagcgacaagcagcgagac
agagtagcaaagggccacagggacgcgaaaaaccccctagatgccaccaaacatttgcgc
ctatcggactgcttgcgtaccgtgcaaaaacttgctattgaacttgagagcgccgacgcc
ggcagcgacgccagcgcccaagccaaagctagtgccgacgccagcagcgccgtcatgtcc
gagacgggttgtcggcactatcaaagctatgtgaaggagcacagctacgatacattccgg
gtcatcgacgcctacttcgctgcctgcgtcaacagagatgcgcgcgagcgaaaggctatt
cactgcaactgcttcgagtgcggcagctacggcatccagttgtacgcttgcctgcactgc
atctacttcggctgccggggggcccacatcacgagtcacctgcgatccaagaagcacaat
gtggccctggagctgtcccacggaacgctctactgctacgcctgcagggatttcatctac
gacgcgcggagccgcgagtatgcgctgatcaaccgcaagctggaggccaaggatctgcag
aagagcatcggctgggtgccgtgggttcccacgaccaaggagaccaatctgctgctggcc
aatgcgaggcgtcggctggtgaggcccaatcaaacgatcggactgaggggtctgcttaat
ctgggcgccacttgcttcatgaactgcatcgtccaggctctggttcacacacccctgctt
agcgattacttcatgtcagatcgccacgactgcggcagcaagtcatcgcacaaatgtctc
gtttgtgaagtgtcacgtctcttccaggagttctattccggctcccgttcgccgttgtcg
ctgcatcggctactgcatttaatctggaaccatgcgaagcacttggccggctacgagcag
caggacgcgcatgagttcttcatcgccactctggacgtgctgcatcggcactgcgtgaag
gcaaaggcggagcacgacagcaagagcaacagctctggctcgggaagtggaactaattcc
agcaactctagcagctcgcattgctacggccagtgtaattgcatcattgaccagatcttc
acgggcatgctgcagagcgatgtggtgtgccaggcgtgcaacggagtgtccaccacgtac
gatccgttttgggacatttcgctggacctgggcgaaacaacaacgcatggtggtgttacc
ccaaaaacgctgatagactgcctggagcggtacactcgggccgagcatctcggatcggcc
gccaagatcaagtgctctacctgcaaatcctaccaggagtccaccaaacagttcagcttg
cgcacgctgcccagcgtggtgtccttccatctgaaacgcttcgagcactcagctctgatc
gatcgcaagatctcctcgttcattcagttccccgtggagttcgacatgacgccctttatg
tcggagaagaagaacgcctacggagacttccggttctctctgtacgccgtggtcaatcat
gtgggcaccatcgacaccggccactatacggcgtatgtgcggcaccagaaggacacgtgg
gtcaagtgcgatgatcatgtgataacgatggcatcgctcaagcaggtgctggacagcgag
ggttatttattgttctaccataaaaacgtgctggaatacgagtaa

DBGET integrated database retrieval system