KEGG   Drosophila simulans: Dsimw501_GD12529Help
Entry
Dsimw501_GD12529  CDS       T01065                                 

Gene name
Dsim_GD12529
Definition
(RefSeq) GD12529 gene product from transcript GD12529-RB (EC:2.7.11.-)
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsimw501_GD12529 (Dsim_GD12529)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   Dsimw501_GD12529 (Dsim_GD12529)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 585 aa AA seqDB search
MDLWNIFLEHILVACRISTSVFANFGCGLYSCWKLFCGDHDTASGLRAGLGTPTQGGKAT
GDNGTTGTPARTIGKPQARIATAMSTATCARFCTPLSSGTAGSTSKLTTGNGSGNTMTSA
YKKKIPSNNSTTANDSSNTETTFTFKLGRSNGRSSSNVASSESSDPLESDYSEEDPEQEQ
QRPDPATNSRSSSTATTTTTSSADHDNDVDEEDEEDDEDEEEGNGRDADDATHDSSESIE
EDDGNETDDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEK
YCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGE
LFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGF
AKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIY
EKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYS
KKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtggaatatatttttggaacatattttagtggcttgcagaatcagcacaagt
gtcttcgcaaatttcggctgcggtttatattcctgctggaagctattctgtggcgaccat
gacacggcttccggtctgcgggcaggacttggcacgcccactcaaggaggaaaagcgaca
ggagacaacgggacgacaggaactccggcaaggacaatcgggaaaccgcaggcgaggatt
gcgacagcgatgtccacggcgacttgtgcccgcttctgcacgcctttgtcatccggcacg
gcaggatccacatcaaaattgacaaccggaaacggaagcggcaacacgatgacgtcggcg
tacaagaagaaaattccatcaaacaacagcacaacagcaaatgacagcagcaacacagag
acaacattcacattcaaattgggccgctcgaacggccgaagtagcagcaatgtagcctca
agcgagtcatccgatccactggagtccgattacagcgaggaggatccggagcaggagcag
cagcgacccgatccggcgaccaacagccggagcagcagcaccgccaccaccaccaccacc
agttccgctgaccatgacaatgacgtcgacgaggaggatgaggaggacgacgaggacgag
gaggagggcaacggccgggatgcggatgacgccactcacgattccagcgagagcatcgag
gaggacgatggcaatgagaccgatgacgaggaggatgacgacgagtccgaggagagcagc
agtgtccagaccgcgaagggagtgcgcaaataccacttggatgactaccagataatcaaa
acagtgggcacgggcacctttggacgagtttgcttatgtcgcgatcgcatttcggagaag
tactgtgccatgaagattctggccatgaccgaagtcattcgtctcaagcagattgaacac
gttaagaacgagcggaatatattgcgcgaaatacgacatccgtttgtcatcagcctcgag
tggtccacaaaggatgactcaaatctgtatatgatcttcgactatgtctgcggtggggag
ctgttcacatatctgcgaaatgcgggaaaattcactagtcaaacctccaatttctatgcg
gctgagatcgtgagtgcgctggaatacctgcactcactgcaaattgtttatcgcgatctg
aagccagagaatctgctgatcaatcgcgatggccatttgaagataaccgattttggcttt
gccaaaaagctgagggatcgcacttggacattgtgcggaacgcccgagtatatagcacct
gagataatccagtccaagggtcataataaagccgtagattggtgggcattgggagttctc
atctacgaaatgctcgtgggatacccaccattctacgatgaacagccctttgggatctac
gagaagatattgagcggtaaaattgagtgggagcgacacatggatcccatagccaaagac
ttgatcaaaaagctgctggtgaatgatagaaccaagcgactgggcaacatgaagaatggc
gccgatgacgtgaagaggcatcgctggttcaagcacttgaattggaatgacgtctacagc
aagaaacttaagccaccaattctgcccgacgtacatcacgatggggataccaaaaatttt
gatgattatcccgaaaaggattggaagcccgccaaggcagtagaccaaagagatttgcag
tacttcaatgatttctaa

DBGET integrated database retrieval system