KEGG   Drosophila simulans: Dsimw501_GD12553Help
Entry
Dsimw501_GD12553  CDS       T01065                                 

Gene name
Dsim_GD12553
Definition
(RefSeq) GD12553 gene product from transcript GD12553-RB (EC:3.6.1.3)
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dsi  Drosophila simulans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dsimw501_GD12553 (Dsim_GD12553)
  Replication and repair
   03420 Nucleotide excision repair
    Dsimw501_GD12553 (Dsim_GD12553)
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dsimw501_GD12553 (Dsim_GD12553)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dsimw501_GD12553 (Dsim_GD12553)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 499 aa AA seqDB search
MADTKSGSGRHSAAGGSGNTVLSPLGQGPANLECKDFQEYLRTRQTPESLEKLYNYPPIC
LAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAI
PGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKDSKPRDIAFLDTYAMSRWRCVLHY
MVGTGNRSGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFML
QYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNNQMLTFLQHLREFGLVFQRKRK
EGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGL
FTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLP
PTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ
KNGHDDVKRYWKKYSKSGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaaatccggtagtggtcggcattcggctgccgggggaagtggaaacacc
gtcctgtcgcccttggggcagggtcctgcgaacttggagtgcaaggactttcaggagtat
ctgcgcacccgccaaacgccagagtcgttggagaagctgtacaactatccgcccatttgt
ttggccgtatttcgggagcttcccgagatagcccggcagtttatcataaggatactgttc
gtggatcagcctgtgccacaagcggtggtcacatcatggggtgcccaacgttgtgccaag
gagcaagccgaggctaccagctgcctgacggctttgaacgtctggcgggtcacagccatt
ccgggtggcctttctgcgtgggagctctcgcccaccttcaagaaaagcgtgcgccaggtg
ctgctgggcggcggaaagccttggcctatgaccaacacgctggataaggactcgaagccc
agggacattgcttttctggatacatacgccatgtcccgctggcgctgcgtgttgcactac
atggtcggcaccggaaatcgcagtggcaccgatgcggaggccattagtccggatgccgtt
aggattctgctgcacgccaatctcatgaaacgggatgaacgagacggtatcacaataacc
cggcagggctttcagttcctgctgctggacacgcgagctcaggtgtggcattttatgcta
cagtacctggacacgtgcgaagaaagaggaatcagcctgccagaatgcttgtccatgttg
ttccagctcagtttttcaacgctgggcagggattacagttcggaggggatgaacaatcag
atgctgaccttcctgcagcatctacgggagtttggactagtcttccaacgtaaacgtaag
gagggacgcttctatcccacacgtttggctctgaatgtgacaagcaaggaggcggctgcg
actgcttctgtggccatggatgaggaggccactcaggactgtggctacatcgtggtggag
acgaactaccgagtgtatgcctacactgattctccgctccaggtagccgtgttgggtctg
ttcacagagctcctctaccgctttcccaatctcgtcgtgggcgtgctgacccgcgattca
gtgcgccaggcgttgcgtggcggtatcacggcggagcagattgtctcgtatctggagcag
tatgcgcatcccaatatgcgcatggtcgagtcagccattcactctaaatcctgcctgcca
cccacagtcgttgatcaaattaagctgtgggaactagagcgaaatcgcttcacctacacc
gaaggcgtgctgtacaatcagttcctctcgcatacagatttcgtaacgctacgagactac
gcccagtcgatccacatgctggtgtggcaaaatgagcgaactcgcacgatggtggtgcaa
aagaatggccacgacgatgtcaagcgttactggaagaaatactctaagagtggtgtttag

DBGET integrated database retrieval system