KEGG   Drosophila simulans: Dsim_GD12553Help
Entry
Dsim_GD12553      CDS       T01065                                 

Definition
GD12553 gene product from transcript GD12553-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dsi  Drosophila simulans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dsim_GD12553
  Replication and repair
   03420 Nucleotide excision repair
    Dsim_GD12553
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dsim_GD12553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 500 aa AA seqDB search
MADTKSGSGRHSAAGGSGNTVLSPLGQGPANLECKDFQEYLRTRQTPESLEKLYNYPPIC
LAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAI
PGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKDSKPRDIAFLDTYAMSRWRCVLHY
MVGTGNRSGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFML
QYLDTCEERGISLPECLSMLFQLTQFSTLGRDYSSEGMNNQMLTFLQHLREFGLVFQRKR
KEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLG
LFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCL
PPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVV
QKNGHDDVKRYWKKYSKSGV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaaatccggtagtggtcggcattcggctgccgggggaagtggaaacacc
gtcctgtcgcccttggggcagggtcctgcgaacttggagtgcaaggactttcaggagtat
ctgcgcacccgccaaacgccagagtcgttggagaagctgtacaactatccgcccatttgt
ttggccgtatttcgggagcttcccgagatagcccggcagtttatcataaggatactgttc
gtggatcagcctgtgccacaagcggtggtcacatcatggggtgcccaacgttgtgccaag
gagcaagccgaggctaccagctgcctgacggctttgaacgtctggcgggtcacagccatt
ccgggtggcctttctgcgtgggagctctcgcccaccttcaagaaaagcgtgcgccaggtg
ctgctgggcggcggaaagccttggcctatgaccaacacgctggataaggactcgaagccc
agggacattgcttttctggatacatacgccatgtcccgctggcgctgcgtgttgcactac
atggtcggcaccggaaatcgcagtggcaccgatgcggaggccattagtccggatgccgtt
aggattctgctgcacgccaatctcatgaaacgggatgaacgagacggtatcacaataacc
cggcagggctttcagttcctgctgctggacacgcgagctcaggtgtggcattttatgcta
cagtacctggacacgtgcgaagaaagaggaatcagcctgccagaatgcttgtccatgttg
ttccagctcactcagttttcaacgctgggcagggattacagttcggaggggatgaacaat
cagatgctgaccttcctgcagcatctacgggagtttggactagtcttccaacgtaaacgt
aaggagggacgcttctatcccacacgtttggctctgaatgtgacaagcaaggaggcggct
gcgactgcttctgtggccatggatgaggaggccactcaggactgtggctacatcgtggtg
gagacgaactaccgagtgtatgcctacactgattctccgctccaggtagccgtgttgggt
ctgttcacagagctcctctaccgctttcccaatctcgtcgtgggcgtgctgacccgcgat
tcagtgcgccaggcgttgcgtggcggtatcacggcggagcagattgtctcgtatctggag
cagtatgcgcatcccaatatgcgcatggtcgagtcagccattcactctaaatcctgcctg
ccacccacagtcgttgatcaaattaagctgtgggaactagagcgaaatcgcttcacctac
accgaaggcgtgctgtacaatcagttcctctcgcatacagatttcgtaacgctacgagac
tacgcccagtcgatccacatgctggtgtggcaaaatgagcgaactcgcacgatggtggtg
caaaagaatggccacgacgatgtcaagcgttactggaagaaatactctaagagtggtgtt
tag

DBGET integrated database retrieval system