KEGG   Drosophila simulans: Dsim_GD12710Help
Entry
Dsim_GD12710      CDS       T01065                                 

Definition
GD12710 gene product from transcript GD12710-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dsim_GD12710
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsim_GD12710
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dsim_GD12710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 813 aa AA seqDB search
MSGGPSITLKSQPIDGNNTGNAAAQPQQQAANGAATAGASGAAGSAQNPGHGGAAAGAGS
VPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRDV
ESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDED
TKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTPELQT
MTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCET
SLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPI
WDTSYRPSNSFVIQQRKRNQEVATVPIGPSAAGIGGSKRTSVGEPLHKRIKKEPTDRPSS
ENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLT
KPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFP
SQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSK
DIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKV
RPGLTCFKEGLPSIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSV
RQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNC
RFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccatccataacgctaaaaagccaacccatcgatggtaacaacacgggc
aacgctgcggcgcaaccccagcagcaggcagcgaatggcgcagcaaccgctggtgcatct
ggagccgctggcagcgcccagaatccaggacacggaggagctgcggccggcgctggcagt
gtgccggcagagggaacgcggcagaacagcctgcagcgcattcagcagcgaaagcaaaag
gtcttcaatctgcccgtgccacagaaattggccaaattgtcgatgtattccgcctgccag
tcggagggatgccgctgcaccggctggaaaacaccgcaggaaaatcgccaccgcgacgtc
gagtcctcctactgtccggagttcaacgaggagtgccgcaacaccagctgtcgccattcg
ctgagatcgcacatagcccatctggacaatatatccagttccagcatgaacgagctactg
ggcgccatcatagacatggagaacctattcatgtccatgcagcgcgtcgaggacgaggac
accaagaaggtgtaccagtacctcttccgtttgctgcgccagtgcgtcctcacgcgccag
caggcggtcatccggggacctctcggcgatccaccattcgagacgccgtgcatcaccaag
gctgtgctctcgctggtcttctacaagtacaatcacctgagcacgcctgaactccaaacc
atgaccgaggtggccaagacgttcttgaactttctgaaccactacaactttgaatcgccg
tcgaccaggaggggagatctcacccacgaggatgcctctaactacaaaatcaactacacc
aggtggttggtgttctgccacgtgcccgccttctgtaactccctgcgccaatgtgaaacg
tccctagtgtttggacgaacgctcctgcgcaccgttttccagtgcatgtcgcagcagctg
aagaagaagtgcatctccgagcgggatcgctttcccgaggacaagcgttcgatcatcacg
ctgatgccgaagtttctggaaacgcttcgcgccgaattgctcaaggatgattcgcccatc
tgggataccagctaccgcccgtcaaattcctttgtcatccagcagagaaagcgtaatcag
gaggtggcaactgtacccattggtcccagtgcagcaggcattggtgggagcaagaggacc
agtgtgggtgaaccgctccacaagcgaatcaaaaaggagcccaccgatcgtccaagcagt
gagaatttggatgacctgcctgcggacgtagtaatgcgcgccatgaaatcggtgtccgag
tcgaagaccaccaacaaagcggaaattctctttccggttaatgtgtcgcgcgatgagaac
gtcaaggcggaggagcagaagcgagccattgagttccatgtggtgggcaattcgctgacc
aaaccggtggacaagcagactgtcttgtggctactgggcctgcagctcgtatttgcctac
cagctacccgagatgccgcgcgagtatatcagccagttggttttcgacaccaagcacaaa
accctggcgctcatcaaggaaaaccagcccatcggcggcatctgtttccgcccgtttccg
tcgcagggcttcaccgagatcgttttctgcgcggtcaccatgtcggaacaagtgaagggc
tatggcacgcacttgatgaaccacttgaaggactacagcatacagaggggcatcaagcat
ctcctcacattcgccgattgcgatgccatcgggtacttcaagaagcagggtttctccaag
gacatcaaattggcgcgaccagtttatgcgggctacatcaaggagtacgatagtgccact
ctcatgcactgcgagctgcatccaagcattgtgaacacgcagttcatagctgtaattcgc
agtcagagcgagattctgaaggagctgatcgcacaacgccacaacgaggtgcagaaagta
agacccggcttgacctgcttcaaggagggcctgccctcgattcccgtggaatcgattcct
ggtctgcgggagatcggttggaagccgcaaaatcgcccggcgcgctcttcgcgacccctc
gaggagtccaccgatccggagaagctggccacgtcctttgcatctgtgctgcaatccgtg
cgccagcacaccaccgcctggcccttcctgcgcccggtgactgcggccgaggttccggac
tactacgatcacatcaaatatcccatggacctgaagaccatgggcgagcgcctgaagaag
ggttactaccaaacgcgccgcctgttcatggcggacatggcgcgcatcttctccaactgt
cggttctacaattcgcccgacaccgagtattatcggtgtgccaactccctggagcgctac
ttccagaccaagatgcgcgagctggggctgtgggacaaatga

DBGET integrated database retrieval system