KEGG   Drosophila simulans: Dsimw501_GD12919Help
Entry
Dsimw501_GD12919  CDS       T01065                                 

Gene name
Dsim_GD12919
Definition
(RefSeq) GD12919 gene product from transcript GD12919-RA (EC:3.4.19.-)
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD12919 (Dsim_GD12919)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dsimw501_GD12919 (Dsim_GD12919)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    Dsimw501_GD12919 (Dsim_GD12919)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 324 aa AA seqDB search
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARPTLFELDTKSQKKDDDVYHFVGYMPIGGRLYELDGLR
EGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNP
APNAMDTEEDRQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKMLGENGQL
MPIYEKAKQRALEREQAQRKKDTD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggtgctggaaattggtgtctcattgaatccgatcccggggtgttcacagag
cttattcgcgaattcggatgcgatggcgcacaggtggaggagatctggagtctggacagc
gagtccttcaagaacctagagcccatccatggtctgatcttcctgttcaagtgggtgcag
gaggatgaacccgctggaaaagtggtcctggaccgagagaacatcttcttcgccaagcag
gtgatcaacaacgcatgcgccacccaggcgatcttgagcctgctgatgaacctggagcat
gaggacatcaagttgggcgagactctcaccaattttaaggagttctgccagtgcttcgat
ccctataacaagggattaactttgagcaacgctagccagattcgcacggtgcacaactcc
tttgctcgcccaacactcttcgagctggacaccaagagccagaagaaggacgatgacgtg
taccactttgtcggctatatgcccatcggaggaagactgtacgagctggacggcctgaga
gagggacccatagatcttggtgagatcaagccggagcagaactggatcgatgtggtgcgt
ccgattattgagaagcgcatgcagcgctacagcgacggcgagatccacttcaacctgatg
gctctgatctcggacaggcagcgcatttacgaacagcagattgagaagctgctcaatccg
gcgcccaatgctatggacactgaggaggaccgacaggcggagatcagtagcttgcgcacg
tacatagagtacgagatccagaagaagaaacgctacaaggtggagaatgtgcggcgcaag
cacaactatttgcccttcatcgtggagctgctgaaaatgctgggcgagaacggacaactg
atgcccatctacgagaaggccaagcagagagcgctagaacgcgagcaggcgcagcgcaaa
aaggataccgactaa

DBGET integrated database retrieval system