KEGG   Drosophila simulans: Dsim_GD12928Help
Entry
Dsim_GD12928      CDS       T01065                                 

Definition
GD12928 gene product from transcript GD12928-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD12928
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsim_GD12928
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsim_GD12928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 269 aa AA seqDB search
MVVLETEKMQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAKAEAKDVKPKED
PQETGEPAGSTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSF
DTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKSDLD
NLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTANGNNEEAALEIGHKLRDALR
LGRNNSLQYQLHKDTMVKQSSNVKSIYTL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttggagacggagaagatgcagagcgactttcacagaatgaagaactttgcc
aatcccaagtccatgttcaaaaccagtgcccccagcaccgagcagggtcgtccggaacca
ccaacttcggctgcagcgcccgccaaggccgaggctaaggatgtcaagcccaaggaggac
ccacaggagacaggtgaaccagcaggcagcactgcaaccaccactgctcctgccggcgac
gatgctgtgcgcaccgagcatctgtacaaacacccgctcatgaatgtctggacgctgtgg
taccttgaaaacgatcggtccaagtcctgggaggacatgcaaaacgagatcacaagcttc
gataccgtcgaggacttctggagcctatacaaccacatcaagcccccatcagagatcaag
ctgggcagtgactactcgctattcaagaagaacattcgtcccatgtgggaggatgcagcc
aacaaacagggcggtcgttgggtgattacccttaacaaaagctccaagagcgatctggat
aacctttggctcgatgtgctgctctgcctgattggcgaggccttcgatcactccgatcag
atctgtggcgctgttataaacattcgcggcaagagcaacaagatatccatctggactgcc
aacggaaacaacgaggaagctgcccttgagattggtcacaagctgcgcgatgccctgcgt
ctgggacgcaacaactcgctgcagtatcagttgcacaaggacaccatggtcaagcagagc
tccaacgtgaaatcgatctacactttgtag

DBGET integrated database retrieval system