KEGG   Drosophila simulans: Dsimw501_GD12937Help
Entry
Dsimw501_GD12937  CDS       T01065                                 

Gene name
Dsim_GD12937
Definition
(RefSeq) GD12937 gene product from transcript GD12937-RD
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsi  Drosophila simulans
Pathway
dsi00040  Pentose and glucuronate interconversions
dsi00052  Galactose metabolism
dsi00500  Starch and sucrose metabolism
dsi00520  Amino sugar and nucleotide sugar metabolism
dsi01100  Metabolic pathways
Module
dsi_M00361  Nucleotide sugar biosynthesis, eukaryotes
dsi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD12937 (Dsim_GD12937)
   00052 Galactose metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
   00500 Starch and sucrose metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
   00520 Amino sugar and nucleotide sugar metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dsimw501_GD12937 (Dsim_GD12937)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6737399
NCBI-ProteinID: XP_016031154
UniProt: A5XCP2
Position
3L
AA seq 511 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
IEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKT
LENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggtcaccagcgagcaccgtccgactcc
aaggagttccatgaggtgaccaaacgggatgcactacgtctgctggagcacgatgtggac
cgtctgctggagaccactgagaaggcccgccagcctgccctcaaggcggaaatgggtcgt
ttcgccgatctgttcgggcgtttcattcaggaagagggtcccgcattggactggaacaag
attcagaagctacctgagaatgctgtgatgaactactcgaatcttaagtcacccaagaac
gagcagatccgcaacatgttggataaattggttgtcatcaagctgaacggtggtttgggc
acctcaatgggttgccatggtcccaagagtgtgattcccgtccgctcggaccttactttc
ctggatctgaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaatgttccg
ctggtactgatgaactcctttaacaccgacgaggataccgagaagatcgtgcgcaagtac
aaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatcagtcgc
gagcactacctgccggtggccaaagactttgacgtcgaaaaggatatggaggcctggtat
ccacctggacacggtgacttctacgataccttccgcaactctggtctgctgaagaagttc
atcgaggagggtcgcgagtactgctttttgtccaacatcgacaacctgggcgccaccgtc
gatctgaacatccttaacaagctggtgggcgaggagcgtgccaccactcctgtggagttt
gtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcattcaaatg
gaaaacaagctgcgcctgttggaaattgcccaagtgcccccagagcatgtggatgacttc
aagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctggcagcc
attgatcgcgttttgcgtgagcgtaccctaaacatggaaattattgtgaacaacaagacg
ctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatgaagtgc
tttgacggcgccatcggcatcaatgtgcctcgttcccgtttcttgcccgtgaagaagtct
tcagatctgctgctggtcatgtcaaatttgtatacgcttaaaaacggcagcctggtaatg
tcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccacttctcg
aaggtgaaggagttcctgggtcgcttcgccaacatcccggatatcattgagctggatcac
ttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcactgtgatc
atcattgccaaccatggcgatcgtatcgatatcccagctggagccattctggagaacaag
attgtatctggcaatatgcgcatcttggaccattaa

DBGET integrated database retrieval system