KEGG   Drosophila simulans: Dsimw501_GD12937Help
Entry
Dsimw501_GD12937  CDS       T01065                                 

Gene name
Dsim_GD12937
Definition
(RefSeq) GD12937 gene product from transcript GD12937-RD (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD12937 (Dsim_GD12937)
   00052 Galactose metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
   00500 Starch and sucrose metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
   00520 Amino sugar and nucleotide sugar metabolism
    Dsimw501_GD12937 (Dsim_GD12937)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dsimw501_GD12937 (Dsim_GD12937)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 511 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
IEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKT
LENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggtcaccagcgagcaccgtccgactcc
aaggagttccatgaggtgaccaaacgggatgcactacgtctgctggagcacgatgtggac
cgtctgctggagaccactgagaaggcccgccagcctgccctcaaggcggaaatgggtcgt
ttcgccgatctgttcgggcgtttcattcaggaagagggtcccgcattggactggaacaag
attcagaagctacctgagaatgctgtgatgaactactcgaatcttaagtcacccaagaac
gagcagatccgcaacatgttggataaattggttgtcatcaagctgaacggtggtttgggc
acctcaatgggttgccatggtcccaagagtgtgattcccgtccgctcggaccttactttc
ctggatctgaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaatgttccg
ctggtactgatgaactcctttaacaccgacgaggataccgagaagatcgtgcgcaagtac
aaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatcagtcgc
gagcactacctgccggtggccaaagactttgacgtcgaaaaggatatggaggcctggtat
ccacctggacacggtgacttctacgataccttccgcaactctggtctgctgaagaagttc
atcgaggagggtcgcgagtactgctttttgtccaacatcgacaacctgggcgccaccgtc
gatctgaacatccttaacaagctggtgggcgaggagcgtgccaccactcctgtggagttt
gtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcattcaaatg
gaaaacaagctgcgcctgttggaaattgcccaagtgcccccagagcatgtggatgacttc
aagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctggcagcc
attgatcgcgttttgcgtgagcgtaccctaaacatggaaattattgtgaacaacaagacg
ctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatgaagtgc
tttgacggcgccatcggcatcaatgtgcctcgttcccgtttcttgcccgtgaagaagtct
tcagatctgctgctggtcatgtcaaatttgtatacgcttaaaaacggcagcctggtaatg
tcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccacttctcg
aaggtgaaggagttcctgggtcgcttcgccaacatcccggatatcattgagctggatcac
ttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcactgtgatc
atcattgccaaccatggcgatcgtatcgatatcccagctggagccattctggagaacaag
attgtatctggcaatatgcgcatcttggaccattaa

DBGET integrated database retrieval system