KEGG   Drosophila simulans: Dsim_GD12937Help
Entry
Dsim_GD12937      CDS       T01065                                 

Definition
GD12937 gene product from transcript GD12937-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsi  Drosophila simulans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsim_GD12937
   00052 Galactose metabolism
    Dsim_GD12937
   00500 Starch and sucrose metabolism
    Dsim_GD12937
   00520 Amino sugar and nucleotide sugar metabolism
    Dsim_GD12937
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dsim_GD12937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 531 aa AA seqDB search
MLDVPHEAKFTMPSGIRPIDVLLERAGVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRL
LETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQ
NEIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVP
LVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWY
PPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEF
VMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAA
IDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKS
SDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDH
LTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaagttcacaatgccctccggtataagacccatcgat
gttctgctggaacgtgccggtgtgcgcggtcaccagcgagcaccgtccgactccaaggag
ttccatgaggtgaccaaacgggatgcactacgtctgctggagcacgatgtggaccgtctg
ctggagaccactgagaaggcccgccagcctgccctcaaggcggaaatgggtcgtttcgcc
gatctgttcgggcgtttcattcaggaagagggtcccgcattggactggaacaagattcag
aagctacctgagaatgctgtgatgaactactcgaatcttaagtcacccaagaacgagcag
aatgagatccgcaacatgttggataaattggttgtcatcaagctgaacggtggtttgggc
acctcaatgggttgccatggtcccaagagtgtgattcccgtccgctcggaccttactttc
ctggatctgaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaatgttccg
ctggtactgatgaactcctttaacaccgacgaggataccgagaagatcgtgcgcaagtac
aaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatcagtcgc
gagcactacctgccggtggccaaagactttgacgtcgaaaaggatatggaggcctggtat
ccacctggacacggtgacttctacgataccttccgcaactctggtctgctgaagaagttc
atcgaggagggtcgcgagtactgctttttgtccaacatcgacaacctgggcgccaccgtc
gatctgaacatccttaacaagctggtgggcgaggagcgtgccaccactcctgtggagttt
gtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcattcaaatg
gaaaacaagctgcgcctgttggaaattgcccaagtgcccccagagcatgtggatgacttc
aagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctggcagcc
attgatcgcgttttgcgtgagcgtaccctaaacatggaaattattgtgaacaacaagacg
ctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatgaagtgc
tttgacggcgccatcggcatcaatgtgcctcgttcccgtttcttgcccgtgaagaagtct
tcagatctgctgctggtcatgtcaaatttgtatacgcttaaaaacggcagcctggtaatg
tcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccacttctcg
aaggtgaaggagttcctgggtcgcttcgccaacatcccggatatcattgagctggatcac
ttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcactgtgatc
atcattgccaaccatggcgatcgtatcgatatcccagctggagccattctggagaacaag
attgtatctggcaatatgcgcatcttggaccattaa

DBGET integrated database retrieval system