KEGG   Drosophila simulans: Dsimw501_GD13034Help
Entry
Dsimw501_GD13034  CDS       T01065                                 

Gene name
Dsim_GD13034
Definition
(RefSeq) GD13034 gene product from transcript GD13034-RC
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dsimw501_GD13034 (Dsim_GD13034)
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsimw501_GD13034 (Dsim_GD13034)
Transcription factors [BR:dsi03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dsimw501_GD13034 (Dsim_GD13034)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dsimw501_GD13034 (Dsim_GD13034)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 1010 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVNDLSALISTSSRKMDKSTVLKSTIAFLKN
HNEATDRSKVFEIQQDWKPAFLSNDEYTHLMLESLDGFMMVFSSMGSIFYASESITSQLG
YLPQDLYNMTIYDLAYEMDHEALLNIFMNPTPVIEPRQTDISSSNQITFYTHLRRGGMEK
VDANAYELVKFVGYFRNDTNTSTGSSSEVSNGSNGQPAVLPRIFQQNPNAEVDKKLVFVG
TGRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYY
HFDDLDSIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYYVSYHQFNSKPDYVVCTH
KVVSYAEVLKDSRKECQKSVNSNSTTNNGSSKVIASTGTSSKSASATTTLRDFELSSQNL
DSTLLGNSLASLGNETAATSPAVDSSPMWSASAVQPSGSCQINPLKTSRPASSYGNISST
GISPKAKRKCYFYNNRGNDSDSTSMSTDSVTSRQSMMTHVSSQSQRQRSHHRENHHSQSH
HHMQQQQQHQNQQQQHQQHQQLQQQLQHTVGTPKMVPLLPIAPTQIMAGNACQFPQPAYP
LASPQLVAPTFLEPPQYLTAIPMQPVIAPFPVAPVLSPLPVQSQTDMLPDTVVMTPTQSQ
LQDQLQRKHDELQKLILQQQNELRIVSEQLLLSRYTYLQPMMSMGFAPGNMTAAAVGNLG
AGGQRGLNFTGSNAVQPQFNQYGFALNSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQ
SHSKAGRPSTVQYKFNYSQAQQQQQQQQQQQQQQQQQQLQLQQQNDILLREDIDDIDAFL
NLSPLHSLGSQSTINPFNSSSNNNNQSYNGGSNLNNGNQNNNNRSSNPPQNNNEDSLLSY
MQMATESSPSINFHMGISDDGSETQSEDNKMMHTSGSNLVQQQQQQQQQQILQQHQQQSN
SFFSSNPFLNSQNQNQNQLPNDLEILPYQMSQEQSQNLFNSPHTAPGSSQ
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgacaaggatgatacgaaaaggaaatcgcgtaatctcagcgag
aagaagcgacgggatcagtttaactcgctggtcaacgatctgagcgccttgatatccacc
tccagcagaaagatggataagtccacggtcctgaagtccacgatagccttcctgaagaat
cataatgaggccaccgaccgctccaaggttttcgaaatacaacaggactggaagccagcg
ttcctcagcaacgacgaatacactcacctcatgctggagtctctcgatggtttcatgatg
gtcttcagcagcatgggctccatcttctacgcctcggaaagtattacctcccagctgggc
tatctgccgcaagatttgtacaacatgaccatatatgacctggcctacgagatggaccat
gaggcgctgctgaacatctttatgaatcccacaccggtaatcgagcccagacagacggat
ataagttccagtaaccagatcacattctacacccatttgagacgcggcgggatggagaaa
gtggatgccaatgcctacgagttggtcaaattcgtgggctactttcgtaacgataccaat
acttcgacgggttccagttcagaggtttcgaatggctcaaatggacagcctgcggtgctg
ccgcgcatcttccagcagaatcccaatgcagaggtggacaaaaagctggttttcgtgggc
accggacgcgtacagaatccccaactgatcagggaaatgagcattattgatcccacaagt
aatgagttcacctcgaaacacagcatggagtggaagtttttgtttctggatcaccgggct
ccgccgatcattggctatatgcccttcgaggttctggggacatccggctatgattattac
cactttgatgatctggacagtattgtggcgtgccatgaagagctaaggcaaacgggtgag
ggcaagtcttgctactaccgattcctcacgaagggccaacagtggatatggttgcaaacg
gactactatgtgagctaccaccagttcaattccaaaccggactacgtggtctgcacccat
aaggttgtcagctatgccgaggttctgaaggatagtcgaaaggagtgccaaaaatccgta
aatagcaacagcaccaccaacaatgggagcagtaaggtaatagcctccacgggaactagc
agcaaatccgcatctgccaccacaacactgagggatttcgagctgagcagccaaaatctg
gatagcacattgctcggaaatagtctggccagtttgggcaatgaaacagcagccacttct
cccgccgtggactcatcgcccatgtggtcagcgtcggctgtccaaccgtctggatcatgc
caaataaatcccctgaagacatcgcgtcccgcctcgagttatggaaatatcagctccaca
ggaatatcgccgaaggccaagcgaaagtgctacttctacaacaaccggggcaatgactcg
gattcaacgtccatgtcgacggattcagtcaccagccggcagtctatgatgacgcacgtc
agttcgcaaagccaacggcagcgatcgcatcaccgagaaaatcatcacagtcagtcacat
catcacatgcagcaacagcagcagcatcagaaccagcagcagcaacatcagcagcaccag
caactgcaacagcagctgcaacatacagtgggtactccgaaaatggtgcctctcctgccg
attgcgcccacacaaataatggctggaaatgcgtgtcagtttccccaacccgcctatccg
cttgctagtcctcaactggtggcacccacatttctggagccgccgcaatatctcaccgcc
attcccatgcagccagtgatcgctccgtttccggtggcgccagtgctttccccacttccg
gtgcagtcacaaacggatatgctgcccgatacggtggttatgacgccaacacagagtcag
ttgcaggatcaattgcagcggaagcacgacgaactgcaaaaactgatcctccagcaacag
aatgagctgaggatcgtctcagagcagctcctcctatcccgctacacatatctgcagccc
atgatgtcgatgggattcgcacctggcaacatgacagcagcagcggtgggtaatttggga
gcaggtggccaacggggactgaatttcaccggcagcaatgccgtgcagccacaattcaat
cagtatggatttgccctgaactcggagcagatgcttaaccagcaggatcagcagatgatg
atgcagcagcagcagaatctgcacacgcagcaccagcacaatctgcagcagcaacatcag
agccactcaaaagcaggacgtccatcaacggtgcaatataagttcaactactcacaggct
cagcaacagcagcagcaacagcagcaacaacagcagcaacagcagcagcaacagttgcag
ctgcagcaacaaaatgatattttactgcgtgaggatatcgatgatatagacgccttcctc
aatctgtcccccctgcactcactgggctcgcaatccaccattaatcccttcaactccagc
agcaataacaacaatcaaagctacaatgggggcagtaatctgaataatggcaaccagaac
aacaacaatcgcagttcgaatcccccgcaaaataacaacgaggactcgctgttgtcctac
atgcagatggccaccgaatcgagtccttcgatcaactttcacatgggcatcagcgatgat
ggctccgaaacgcagagcgaggacaacaagatgatgcacacttccggcagcaatctggtg
cagcagcaacagcagcagcaacaacaacaaatcctgcagcagcatcagcagcagtcaaac
agcttcttcagttcgaatccctttctcaacagtcagaatcagaaccaaaaccagttgcca
aacgatctggaaatattgccataccaaatgtcccaagagcaatcacagaatctattcaac
tcgcctcacacagccccaggcagtagtcaatag

DBGET integrated database retrieval system