KEGG   Drosophila simulans: Dsim_GD13080Help
Entry
Dsim_GD13080      CDS       T01065                                 

Definition
GD13080 gene product from transcript GD13080-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dsi  Drosophila simulans
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dsim_GD13080
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dsim_GD13080
Ubiquitin system [BR:dsi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dsim_GD13080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 900 aa AA seqDB search
MMIQEPVQAAIWHCLNYYDFKDAVFLSERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESSLISTGFADAKNCDELQRDFGDLACFAYQLM
AQICMRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAATIFQIHSTDVFNTCQG
SSVNANAMVLFGAEQHSQQHQERQSLITNLSNVSNYILTTPVDQQQQQINQNQNQHHNSN
MVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGAPQDTAGQYQQNQQLYDMS
SGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNISYSPMPQMLVEV
NQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMNVPPNP
NAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKAKSRMTKICLNNELIEEKSHH
LSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQSADGLM
ALLRGLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAVAIF
ETIHKAEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSAVTWCVSGNCFSLQKE
HETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRDPRHYNAWYGIG
TIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAATLDPKN
PLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLALMHFSW
ATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGSYDSDY
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcattgcctgaactactacgacttc
aaggatgccgttttcctgtcggaacgactgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgatccaatcaggtgcaccaggcatactggctgctg
aaggagaaggcacgccgctcgccgcagtgccgctttctgcaggccaaatgcgcctacgag
ctgaagaaatacgccgaagcagagagctccttaatctccacgggattcgcggacgccaag
aactgcgatgagctgcagcgggacttcggggatctggcctgcttcgcctatcagctgatg
gcccagatctgcatgaggaccgagcgcaacaaactggctgtcagtgctttaaggcgcgcc
ctcaagctgaaccccttcatgtggcacgcattcgcggatctgtgcctgctgggccaggac
acagatgcggcgaccatattccagatccacagcacagatgtgttcaatacctgccagggc
agcagcgtaaatgccaatgcaatggtgctgttcggcgccgagcagcatagtcaacagcat
caggagcgccagtcactgatcaccaacctaagcaatgtctccaactacattctgaccacg
cccgtggatcagcagcaacaacagatcaaccagaatcagaaccagcaccacaacagcaac
atggtgacgcccatcaacaataataataataacaataatctcaatagttcgatcagcatg
ctgcgcggcggtttggtgcaaaactctagcatgctggcgatgctggaggacacacctatg
ggggctccgcaggacacggccggccagtatcagcagaaccagcagctctacgacatgagc
agcggcactccgttccgcaaacagttcaaatacctatcggcgatctcaccgccaactccg
agcttcggcatcatgcctttaactagtccttgcaccggcaacgatggatccttcatcggc
aaccacacgcccgttatgaatattagctattcgccgatgccgcagatgctggtcgaggtc
aaccaggagccgaagatgatgggcaaaaagctgaagacacatgtgggcggactcataaat
cgcaaggagggcagccttaataaacccgccgtctttacgcaagccggaaacataacgccc
cgcactccgaacaacaataatgtgggcaacaatggcaatatgaatgtgccgcccaatccg
aatgctgcagtgcgtcgcagttcgcggctgttcagcaactcgtattcggtgaaggagaac
aataaatcgcccaacatagccaacaagttcgtgcagccacgttcgccgccccgcaaagcc
aagtcacggatgaccaagatctgcctgaataacgaactgatcgaggagaagtcccaccac
ctctccgagaagcgcaaggagaaggtggagactattacatcctcgggagcgaataacaac
agcggtggacgcagtgccgccgaggaggccaaagtactgctgaacaatagcctaaacaac
gcccagacgatggcccaccagctgatgggactgaagaaacagtcggccgatggactgatg
gccctgctgcggggtttagctgaagcctatcagctgctctcgaacttccagtgcaaggcg
gccataaagcagctggagacgacgataccaaagcaccacctgaactccagctgggtgcag
tcgctcatcggactggccaggtacgagatgcgcgagtatgaggcggcggtggcgatattt
gagaccatccacaaggcggagccatgtcgcttggactacatggagatatactcgtcatcc
ctgtggcatctgcagcgcgaggttgagctgtcggctctcgcccaggatctgattaaccag
gacaaaaccagcgcggttacctggtgtgtgtccggcaattgtttctcgctgcaaaaggag
cacgaaaccgcgatcaagttcttcaagcgggctgtccaagtggatccagacttcgtctac
agctacacactgctgggccacgaacttgtactcaccgaagaatttgacaaggcgatggac
tacttccgggccgcagtggttagagatccgcggcattacaacgcttggtacggcatcggc
accatatactccaagcaggagaagtacgagctggctgagattcactacgtgaaggcgctg
aaaatcaatccacagaactcggtcatccttgtgcacatcggcgccatgcaattctacatg
aagaagaaggatctgtcgctgcagacgctaaacacggccgccacgctggaccccaagaac
ccgctgacgcgattccatcgcggctccatctacttctcgctgggcaagtaccaggaggcg
ctgcgcgaactggaggagcttaaggaagtcgtgcccaaggagtcggtggtgttctatctg
atcggcaaaatccacaagacgctcggcaacatggatctggcgctgatgcacttcagctgg
gccaccgacctggatcccaagggtgccaacaatcaaatcaaagatgccttcgactccatg
gcccatcccagctgctgtccggccaacacaacggccctggacgttgatctggagcccact
tcggagcgttccgatgactcaacgcaggcgcagcaggacggaagctacgacagcgactac
tag

DBGET integrated database retrieval system