KEGG   Drosophila simulans: Dsimw501_GD13118Help
Entry
Dsimw501_GD13118  CDS       T01065                                 

Gene name
Dsim_GD13118
Definition
(RefSeq) GD13118 gene product from transcript GD13118-RA
  KO
K03259  translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
dsi03013  RNA transport
dsi04150  mTOR signaling pathway
Module
dsi_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD13118 (Dsim_GD13118)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsimw501_GD13118 (Dsim_GD13118)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsimw501_GD13118 (Dsim_GD13118)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsimw501_GD13118 (Dsim_GD13118)
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsimw501_GD13118 (Dsim_GD13118)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6737036
NCBI-ProteinID: XP_002083883
UniProt: B4QJS7
Position
3L
AA seq 229 aa AA seqDB search
MLTTQQTEFKMMDNGTETLADSHSSSSEDLKALSEMDIRKPLTEIVDLRLKHPLENTWTL
WYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDP
ANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT
ANGHNELAVMEIGLKLRDLLVLPPHQLQYQLHKDTMCKQGSVIKAVYCV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgacccagcagaccgaattcaagatgatggacaacggcaccgagacgctggcc
gattctcattcgagttccagtgaggatctgaaagcactttcggagatggatattcgcaag
cccctaacggagattgttgacttgcgccttaagcatccgctagagaacacttggacccta
tggtacctggagaatgatcgcagcaagaactgggaggacatgcagaacgagatcactagc
ttcgacatggtcgaggacttctggagtctctacaatcacattaagcaaccatctgagatt
agagtgggcagcgattattctttgttcaagaagggcattcagccaatgtgggaggatcct
gcaaacaagttcggcggccgttgggtcatcaatatggggcgtggctccaaagcggagctc
gacaagctttggctagatgtgctactcatactgattggcgaggcctttgaaaacaccgaa
gaagtctgcggcgctgttatcaacttgcgcgggaagagcaacaaaatttcgatttggacc
gccaacggacacaacgagctggccgtcatggagattggactcaagttacgcgacctgctc
gtcctgccgccccaccaactgcagtaccagctgcacaaggacactatgtgcaagcaggga
tcggtgatcaaagcggtttattgcgtgtaa

DBGET integrated database retrieval system