KEGG   Drosophila simulans: Dsim_GD13186Help
Entry
Dsim_GD13186      CDS       T01065                                 

Definition
GD13186 gene product from transcript GD13186-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dsi  Drosophila simulans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsim_GD13186
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dsim_GD13186
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsim_GD13186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 524 aa AA seqDB search
MVKSCLILCFFALLVIQARSDLADDQEHAQHPRLQTSRDFEALDEELDTRFWHDKAQSIL
ADKLAGHRKLNENRAKNVILFLGDGMSVHTITATRAFMGDSNKQVFFEKFPYLGLSKTYA
VNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSSHVQSIGQWAQEAGKWAG
VVTTARVTHASPAGVYAHVAERNWEHDGEIISSKCSPDVNTDIARQLVEWPVGQELRVIM
GGGRSYFRDQSQHDETGVSGLRTDGRDLISDWREIKKQQGAEGKYVWSLKGLKETDLSKT
DYLLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSKNEEGYFLFVESGRIDMA
HHATKAKKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSHTMSINGYPYRRQNILSLA
PNLADDELPFTVLSYANGPGFADTYSTKDGRIDLSHADTTSAEFEFQATVPLSSETHGAE
DVGVFASGPFEHLFTGNYEQSSIPAMMAYAANIGPFAKDKINEE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagagttgcctgatcttgtgcttcttcgctctcctggtcatccaggcccggagt
gatctagccgatgaccaagaacacgcccaacatccccgtctgcaaacatcacgcgacttc
gaggccctcgacgaggagctggacacacgattctggcacgataaggcccaatcgattctg
gccgataagctggccggccataggaaactcaacgagaatcgcgccaagaacgtgatccta
tttttgggcgatggcatgtccgtccacacgatcacagccacacgtgctttcatgggcgat
agtaacaagcaggtcttcttcgagaagttcccctacctgggtctgtccaagacgtatgcc
gtcaatgagcgtactccggactcggccaacactgctacggcctatttgacaggagtcaag
gccaactatggcaccattggagtcaatgcccaggtgcagaggggcgactgtgtgaccaat
tcgagtagccatgtccagagcattggtcagtgggcccaggaggccggcaagtgggccggt
gtggttaccaccgcccgggtgacccacgcttctccagccggagtttatgcccatgttgca
gagcgaaattgggagcacgatggtgagatcatcagctccaaatgcagtcccgacgtcaac
accgatattgcccggcagctggtggaatggccagtgggtcaggaactgcgcgtcatcatg
ggcggcggtcgatcctatttccgggatcagtcccagcacgatgagactggcgtttcgggc
ctgcgaaccgatggacgcgatctgatcagcgattggcgagagatcaagaaacagcaggga
gcggagggcaagtacgtctggtcactcaagggcttgaaggaaacggatcttagcaagacg
gattaccttctcggcctctttgacacctcccatctgccctaccatggcgatcgtcgacga
acccattatgaagatgcagagccatccctttccgacatgacagaggctgccatcaagatg
ctcagcaagaacgaagagggttacttcctgttcgtggagagtggacgtatcgatatggcc
catcacgccaccaaggcgaagaaagctttggaggacaccgaagaattcgcggcagccgtg
gaactggcaaggaaaatgaccgacgaggaggacacgctgattgtagtgacttcggatcac
tcgcacaccatgtccattaacggctatccgtaccgtcgacagaacatcctttcccttgct
cccaatctggctgatgatgagctgccctttaccgtcttgtcctatgccaatggtccggga
tttgctgatacctacagcactaaagatggacgcattgatctttcccatgcggacaccacg
agcgcggagtttgagttccaggccacggttcccttgagcagcgaaacccatggcgccgag
gatgtgggtgtctttgcctctggtcccttcgagcacctgttcaccggcaattacgagcag
agttccattccagccatgatggcttatgccgctaacattggaccatttgccaaggacaag
attaatgaggaataa

DBGET integrated database retrieval system