KEGG   Drosophila simulans: Dsim_GD13291Help
Entry
Dsim_GD13291      CDS       T01065                                 

Definition
GD13291 gene product from transcript GD13291-RA
Orthology
K10755  
replication factor C subunit 2/4
Organism
dsi  Drosophila simulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:dsi03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dsi03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dsi03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 331 aa AA seqDB search
MPEEPEKTADDKRSHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGV
GKTTTIQCLARILLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVIL
DEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLA
KLIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHP
KLLEEMIHHCAANDIHKAYKILAKLWKLGYSPEDIIANIFRVCKRINIDEHLKLDFIREI
GMTHMKIIDGINSLLQLTALLAKLCIVAEKH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagaaccagagaaaacggcggacgacaagcgcagtcacttgccctggattgag
aagtaccgccccgtgaagttcaaggagatagtgggtaatgaggataccgtagcaagatta
tcagtattcgccacccagggaaatgcacccaatattattattgctggtcctccaggcgtg
ggcaagacaaccaccatccagtgtcttgctaggattcttctgggagacagctacaaggag
gctgtcctcgagctgaatgcctccaatgaacgaggaatcgatgtggtccgcaacaagatc
aagatgtttgctcagcaaaaggtgacattgccgcggggcaggcacaagattgtgattctg
gacgaggcagacagcatgacggagggtgcccagcaggcactgcgccggaccatggagatc
tacagcagcaccactcgttttgccctggcctgcaacaccagcgagaagatcatagagcct
atccagtcccgctgcgccatgctacgattcaccaagctgtccgatgcgcaagttctggcc
aagctcatcgaggtggccaagtgggagaagctcaactacacagaggacggactggaggcc
atcgtgttcactgcccaaggtgacatgcgacagggactgaacaacctgcagtccaccgcc
cagggatttggcgacatcacagctgagaacgtctttaaggtctgcgacgagccccacccg
aagctcctggaggagatgatccaccattgcgctgccaacgacatacacaaggcgtacaaa
atcctggccaagttgtggaagctgggatactcgccggaagacatcattgcgaacatattc
cgggtctgcaagcgcatcaacatcgatgagcatctaaagctggactttatccgtgagatt
ggcatgacccacatgaagattatcgacggtatcaactcgctgctgcagctcaccgccctc
ctggccaaactctgcattgtcgcagagaagcattag

DBGET integrated database retrieval system