KEGG   Drosophila simulans: Dsim_GD13291Help
Entry
Dsim_GD13291      CDS       T01065                                 

Definition
GD13291 gene product from transcript GD13291-RA
Orthology
K10755  
replication factor C subunit 2/4
Organism
dsi  Drosophila simulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dsim_GD13291
   03420 Nucleotide excision repair
    Dsim_GD13291
   03430 Mismatch repair
    Dsim_GD13291
DNA replication proteins [BR:dsi03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     Dsim_GD13291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 331 aa AA seqDB search
MPEEPEKTADDKRSHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGV
GKTTTIQCLARILLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVIL
DEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLA
KLIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHP
KLLEEMIHHCAANDIHKAYKILAKLWKLGYSPEDIIANIFRVCKRINIDEHLKLDFIREI
GMTHMKIIDGINSLLQLTALLAKLCIVAEKH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagaaccagagaaaacggcggacgacaagcgcagtcacttgccctggattgag
aagtaccgccccgtgaagttcaaggagatagtgggtaatgaggataccgtagcaagatta
tcagtattcgccacccagggaaatgcacccaatattattattgctggtcctccaggcgtg
ggcaagacaaccaccatccagtgtcttgctaggattcttctgggagacagctacaaggag
gctgtcctcgagctgaatgcctccaatgaacgaggaatcgatgtggtccgcaacaagatc
aagatgtttgctcagcaaaaggtgacattgccgcggggcaggcacaagattgtgattctg
gacgaggcagacagcatgacggagggtgcccagcaggcactgcgccggaccatggagatc
tacagcagcaccactcgttttgccctggcctgcaacaccagcgagaagatcatagagcct
atccagtcccgctgcgccatgctacgattcaccaagctgtccgatgcgcaagttctggcc
aagctcatcgaggtggccaagtgggagaagctcaactacacagaggacggactggaggcc
atcgtgttcactgcccaaggtgacatgcgacagggactgaacaacctgcagtccaccgcc
cagggatttggcgacatcacagctgagaacgtctttaaggtctgcgacgagccccacccg
aagctcctggaggagatgatccaccattgcgctgccaacgacatacacaaggcgtacaaa
atcctggccaagttgtggaagctgggatactcgccggaagacatcattgcgaacatattc
cgggtctgcaagcgcatcaacatcgatgagcatctaaagctggactttatccgtgagatt
ggcatgacccacatgaagattatcgacggtatcaactcgctgctgcagctcaccgccctc
ctggccaaactctgcattgtcgcagagaagcattag

DBGET integrated database retrieval system