KEGG   Drosophila simulans: Dsimw501_GD13291Help
Entry
Dsimw501_GD13291  CDS       T01065                                 

Gene name
Dsim_GD13291
Definition
(RefSeq) GD13291 gene product from transcript GD13291-RA
  KO
K10755  
replication factor C subunit 2/4
Organism
dsi  Drosophila simulans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dsimw501_GD13291 (Dsim_GD13291)
   03420 Nucleotide excision repair
    Dsimw501_GD13291 (Dsim_GD13291)
   03430 Mismatch repair
    Dsimw501_GD13291 (Dsim_GD13291)
DNA replication proteins [BR:dsi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    Dsimw501_GD13291 (Dsim_GD13291)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     Dsimw501_GD13291 (Dsim_GD13291)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    Dsimw501_GD13291 (Dsim_GD13291)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    RFC (replication factor C)
     Dsimw501_GD13291 (Dsim_GD13291)
  Check point factors
   HRAD17(Rad24)-RFC complex
    Dsimw501_GD13291 (Dsim_GD13291)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 331 aa AA seqDB search
MPEEPEKTADDKRSHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGV
GKTTTIQCLARILLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVIL
DEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLA
KLIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHP
KLLEEMIHHCAANDIHKAYKILAKLWKLGYSPEDIIANIFRVCKRINIDEHLKLDFIREI
GMTHMKIIDGINSLLQLTALLAKLCIVAEKH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagaaccagagaaaacggcggacgacaagcgcagtcacttgccctggattgag
aagtaccgccccgtgaagttcaaggagatagtgggtaatgaggataccgtagcaagatta
tcagtattcgccacccagggaaatgcacccaatattattattgctggtcctccaggcgtg
ggcaagacaaccaccatccagtgtcttgctaggattcttctgggagacagctacaaggag
gctgtcctcgagctgaatgcctccaatgaacgaggaatcgatgtggtccgcaacaagatc
aagatgtttgctcagcaaaaggtgacattgccgcggggcaggcacaagattgtgattctg
gacgaggcagacagcatgacggagggtgcccagcaggcactgcgccggaccatggagatc
tacagcagcaccactcgttttgccctggcctgcaacaccagcgagaagatcatagagcct
atccagtcccgctgcgccatgctacgattcaccaagctgtccgatgcgcaagttctggcc
aagctcatcgaggtggccaagtgggagaagctcaactacacagaggacggactggaggcc
atcgtgttcactgcccaaggtgacatgcgacagggactgaacaacctgcagtccaccgcc
cagggatttggcgacatcacagctgagaacgtctttaaggtctgcgacgagccccacccg
aagctcctggaggagatgatccaccattgcgctgccaacgacatacacaaggcgtacaaa
atcctggccaagttgtggaagctgggatactcgccggaagacatcattgcgaacatattc
cgggtctgcaagcgcatcaacatcgatgagcatctaaagctggactttatccgtgagatt
ggcatgacccacatgaagattatcgacggtatcaactcgctgctgcagctcaccgccctc
ctggccaaactctgcattgtcgcagagaagcattag

DBGET integrated database retrieval system