KEGG   Drosophila simulans: Dsim_GD13355Help
Entry
Dsim_GD13355      CDS       T01065                                 

Definition
GD13355 gene product from transcript GD13355-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsim_GD13355
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD13355
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsim_GD13355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 826 aa AA seqDB search
MEELRKHLSKVNVPCVSGAGSPPIYKDECVYSYDNPETPTGLYVCLHSFLGFGEGYVREY
ANKTGNRIFLHIQRVKTIKEGADMDADAESEAGPERKITRLAIGVEGGYNESDMAKKYEI
KDTYSIVVAPDLDKKLPYPDPELPMRVTQSVEAILAADSAIAKLEKATLMGTWDGEVRQA
SKYAENLQQLDNGKRIPPSGWQCEKCDLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAVEH
YRVTGFPLAVKLGTITPDGKSDVFSYPEDEMVLDPHLERHLSHFGINMAAMKKSEKSMVE
LELDINQRIGEWSALTESESELQPVAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQQRFV
GTGAERYFSEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHITGISPAMFKNIV
GKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQTNPADALKFLLEDRVECLASRKVKYRT
REEYSFRLPVPLDKATNLDEVREFQERKKAARETGQRLPDRDIVRHKVPLQACLESFFGP
ELIEQFYSTAIDGKTNARKITRLATMPDCLMIHVGKFTLGDDWVPKKLDVSVDMPDELDL
SNWRSAGGLQPGEEALPEPAAEEVKFAFDEAVMSELLTMGFPPEACKRACYHTKNSGLEA
ASNWLMEHIADEDISEPFVVPNNSIGDCAANQFVANPESLAMLMSMGFDERQAVAALKAT
DGNVERATDWIFSHADSISVEEAVPAENSSAAAASSAPNKTDYRDGRGKYRLVGFISHMG
TSAQVGHYVCHIRKKGEWVIFNDSKVAKSQNPPKDLGYLYLYMREQ
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaggaactacgcaagcatttatccaaggtgaacgtgccctgcgtatccggggcgggc
agtcctcccatctacaaagacgagtgcgtctactcttacgacaatcccgagacgcccacc
ggtttgtacgtgtgcctgcacagctttttgggcttcggcgaggggtatgtgcgggagtat
gccaacaagaccggcaaccggatcttcctccacatccagcgggtgaagacgatcaaggag
ggcgccgatatggatgccgatgcggagtcggaggctggaccggaacggaagatcacccgc
ctggccatcggcgtcgagggcggctacaacgagtcggacatggccaagaagtacgagatc
aaggacacgtacagcatcgtggtggcccccgatctggacaagaagctgccctatccggat
ccggagctgcccatgcgtgtcacccaatcggtggaggcgatccttgctgccgactcggca
attgccaagttggagaaggccacgctaatgggcacctgggatggtgaagtgcgtcaggcg
tcgaagtacgcagagaatctgcagcagctggataatggcaagaggattcctccatccggc
tggcagtgcgagaaatgcgatttgaccaacaacctctggcttaatctgaccgatggttcg
atcatgtgcggacgcaagttcttcgacggcagtggcggcaacgatcacgccgtggagcac
tacagagtgacaggtttcccgctggcggtgaaactgggcaccatcacccctgatggcaag
tcggatgtgttctcctacccggaggatgaaatggtactcgatccacacctagagcgccat
ctctcccactttggcatcaacatggcggcgatgaagaagagcgagaagtcgatggtggag
ctagagctggacattaaccagcgcatcggcgagtggtcggcgcttacggagagcgaaagt
gagctgcagcctgttgctggtcctggatacactggcatgcgcaatctgggcaactcctgc
tacatcaacagcgtgatgcaagtgctcttcgtcatcccagacttccagcagcggttcgtg
ggcacaggagcggaacgctatttcagcgagttccccagcgacccggccaacgacttcaac
attcaaatggccaagctgggaactggtctgcagtccggaaagtacagcagtattgccgag
aacactctggacaccgatcacatcaccggaatatcgccggccatgtttaagaacattgtg
ggcaagaatcacccagacttcagcaccaaacagcagcaggatgccaacgatttctacctg
catttgctcaccctgctggacaggaattcgcggaaccaaacaaatcccgcagatgctcta
aagttcctgctggaggatcgcgttgagtgtctggccagccgcaaggtgaagtacaggacc
cgcgaggaatatagtttccgtctgcctgttccgttggacaaggccaccaatctggatgag
gtgcgggagttccaggagcgtaagaaggcggcccgcgagactggacaacggctcccggat
cgcgacatcgtgaggcacaaggtgcctctacaggcctgcctggaaagcttcttcggcccg
gagctgatcgagcaattctactccactgccatcgatggcaagacgaatgccaggaaaatc
acgcgattggccaccatgcccgactgcctgatgattcacgtgggaaagttcacgctgggc
gacgactgggtgcccaaaaaactggacgtttccgtagacatgcccgatgaactggatcta
agcaactggcgttctgctggtggcttgcagcccggtgaggaggctcttcccgagcccgcc
gctgaggaggtgaagtttgcatttgacgaggcggtcatgtccgagttgctgaccatgggc
tttccgccggaagcctgcaagcgtgcttgctatcacacgaaaaacagcgggctggaggca
gcctccaactggttgatggagcacatcgccgacgaggatatctcggagccctttgtggtg
ccgaacaacagcattggagactgcgccgccaaccagtttgtggccaatcccgagagcctg
gccatgctcatgagcatgggcttcgacgaacgacaggcggtggctgctctgaaggcgacc
gatggcaacgtggagcgcgccaccgactggatcttctcgcacgccgattcaattagtgtc
gaggaagctgtccccgctgaaaattcatcagctgcagcggcgtcctcggcgcccaataag
accgactaccgcgatggccgcggcaagtaccgcctggtgggattcatctcacacatgggc
acctccgcccaggtgggacactacgtttgtcacatacgcaagaagggcgaatgggtgatc
ttcaacgacagcaaggtggccaagtcgcagaacccgcccaaggacctcggctatctgtat
ctctatatgcgcgaacagtag

DBGET integrated database retrieval system