KEGG   Drosophila simulans: Dsimw501_GD13383Help
Entry
Dsimw501_GD13383  CDS       T01065                                 

Gene name
Dsim_GD13383
Definition
(RefSeq) GD13383 gene product from transcript GD13383-RA
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsimw501_GD13383 (Dsim_GD13383)
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dsimw501_GD13383 (Dsim_GD13383)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dsimw501_GD13383 (Dsim_GD13383)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 694 aa AA seqDB search
MTKVTEGEISHGVQDVGKYYLNFPILAKGFVRQDSVHDFVNSDSDGDFIALSGSKSEVIT
LELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIYDSCDVLEAQHLALDPAY
TAVCSVSVPPARLTAVKRAPKLVANGNILLGSLNTYGSLSLINKSAEYNRWNPLEGLNIA
ETLRDTLLPEVDIGKIKDFKSYQEYINPAWITMFAWLPDDADSTGQHVLVLGTASGSLWL
LTLSADAKTLLNHQETKTSMGRICHIQAFKDFLLVGDSNGLIHLYQLPAKGNTALVLVKP
LWEKADRMGLQMAVITECPRTDCYYITCCKAAHLLTWSMPRTGNADCLQARIYVGGMKIT
ALCSLDNTSFAAGTAGSYLHCVQIIHENNQLSLQTQSIAMSVLQDFQVMGLCTSRHKNLM
TLFLYRNKEYLNETVSQKNQLVMQVLKVGNQDPLEQLIRHLKSNKPMNHYTDLLAALRLH
VFAEENWQKYMDFGPLDSFEFADSATEDQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKS
RDELQLLLAMLNITHIRLRLQFIGSLSKRTPFQEQAIKCMFEEAHRLINKLNADFTENHV
QGSTAKAFVEQMDSHIKHLHEMLGIPVIANPQKQLHRCSVSFVEISPSLDRRYCSLCDRQ
VLFELDNLRELYESGTNLACPVCHGSFATEMFDA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagttactgagggagaaatttcacatggcgttcaagatgtcgggaaatattat
ctgaattttcctatcctagccaaaggattcgtccgccaggactcggtacacgactttgtc
aatagcgattccgatggagactttatagcactgagcggctccaaatcggaagtgatcacc
ctggagttgagcagcaagttcatggtcgtggatccctttccctattttgtggccatttat
gattccaacgctgcggaaacacgacccctggacgttttggccaacaaagtggatctggtg
gccatatacgacagctgcgatgtcctggaggcacagcacttggccctggacccggcatac
acggctgtgtgctccgtttccgtgccaccagccagattaacagctgttaagagggcacct
aagctggtagctaatggaaatatcctcttgggctccctgaacacctatggatccttgagc
ctgataaacaagtctgcagagtacaatcgttggaaccccctggaaggactaaatatcgct
gaaactctgagggacactctgctgcctgaagtggacatcggcaagattaaagactttaaa
agctatcaagaatatattaaccccgcctggatcactatgtttgcttggttacctgatgat
gcagattccactggccagcatgttttggtgctgggaaccgcttccggaagtttgtggttg
ctcacactaagcgccgatgccaaaactcttttgaatcatcaagaaacgaaaacctcaatg
ggtcgtatctgccatatacaagcattcaaggactttctactggtgggcgatagcaacggc
ctcatccacctgtaccaattgccagcaaagggaaatacagctctcgtcttagtgaagccc
ttgtgggagaaagccgatcgcatgggtctgcaaatggcagtgatcactgaatgtcccaga
acggattgctattatataacctgttgcaaggcggcgcacctgctgacctggagcatgcca
agaacgggaaacgcagactgcctgcaagcacggatctatgtcggcggaatgaagatcacc
gctctctgcagcctggacaacactagctttgctgcaggaaccgctggaagctatctgcat
tgcgtacaaattatccacgagaataatcagcttagcctgcagacgcaatcgatagccatg
agtgtcctccaggatttccaggtgatgggactgtgcaccagtaggcacaaaaacttaatg
accctttttctctaccgcaacaaggaatatctgaatgaaaccgtgtctcaaaagaaccag
ttggttatgcaagtgctcaaggtggggaatcaggatccacttgaacagcttatcaggcat
ctgaaatccaataagcccatgaatcactataccgatttattagctgcactacgtctgcac
gtttttgccgaggagaattggcaaaaatatatggactttggtccattagattcctttgaa
tttgcggattccgccactgaggatcagctgcagcagctgcaaatcaaatttcatgtcctt
caaaacgtgattcgcctgcaatcgagccacctccagctgactgttcacatccaaaagtcg
cgggatgaactgcagctgctccttgcgatgctgaatatcacacacataagactgaggctc
cagttcattgggtcattaagtaagagaacaccattccaggagcaggcgataaagtgtatg
ttcgaggaggcccaccgactgataaataaacttaatgccgactttacggaaaatcatgtc
caaggatccacagcaaaggcattcgttgagcaaatggacagccatattaagcacttgcac
gagatgctgggtatacctgtgatagctaatccccagaagcaacttcatcgatgcagtgtg
tcctttgtggagatctcccccagcttggatcgacgctactgcagcctctgcgaccgccag
gtcctcttcgagctggacaatctgcgagaactctacgagtctgggacaaatctggcatgt
cccgtttgccatggaagctttgccacggaaatgtttgatgcataa

DBGET integrated database retrieval system