KEGG   Drosophila simulans: Dsim_GD13383Help
Entry
Dsim_GD13383      CDS       T01065                                 

Definition
GD13383 gene product from transcript GD13383-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 463 aa AA seqDB search
MTKVTEGEISHGVQDVGKYYLNFPILAKGFVRQDSVHDFVNSDSDGDFIALSGSKSEVIT
LELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIYDSCDVLEAQHLALDPAY
TAVCSVSVPPARLTAVKRAPKLVANGNILLGSLNTYGSLSLINKSAEYNRWNPLEGLNIA
ETLRDTLLPEVDIGKIKDFKSYQEYINPAWITMFAWLPDDADSTGQHVLVLGTASGSLWL
LTLSADAKTLLNHQETKTSMGRICHIQAFKDFLLVGDSNGLIHLYQLPAKGNTALVLVKP
LWEKADRMGLQMAVITECPRTDCYYITCCKAAHLLTWSMPRTGNADCLQARIYVGGMKIT
ALCSLDNTSFAAGTAGSYLHCVQIIHENNQLSLQTQSIAMSVLQDFQVMGLCTSRHKNLM
TLFLYRNKEYLNETVSQKNQLVMQVLKVGNQDPLNSYQASEIQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagttactgagggagaaatttcacatggcgttcaagatgtcgggaaatattat
ctgaattttcctatcctagccaaaggattcgtccgccaggactcggtacacgactttgtc
aatagcgattccgatggagactttatagcactgagcggctccaaatcggaagtgatcacc
ctggagttgagcagcaagttcatggtcgtggatccctttccctattttgtggccatttat
gattccaacgctgcggaaacacgacccctggacgttttggccaacaaagtggatctggtg
gccatatacgacagctgcgatgtcctggaggcacagcacttggccctggacccggcatac
acggctgtgtgctccgtttccgtgccaccagccagattaacagctgttaagagggcacct
aagctggtagctaatggaaatatcctcttgggctccctgaacacctatggatccttgagc
ctgataaacaagtctgcagagtacaatcgttggaaccccctggaaggactaaatatcgct
gaaactctgagggacactctgctgcctgaagtggacatcggcaagattaaagactttaaa
agctatcaagaatatattaaccccgcctggatcactatgtttgcttggttacctgatgat
gcagattccactggccagcatgttttggtgctgggaaccgcttccggaagtttgtggttg
ctcacactaagcgccgatgccaaaactcttttgaatcatcaagaaacgaaaacctcaatg
ggtcgtatctgccatatacaagcattcaaggactttctactggtgggcgatagcaacggc
ctcatccacctgtaccaattgccagcaaagggaaatacagctctcgtcttagtgaagccc
ttgtgggagaaagccgatcgcatgggtctgcaaatggcagtgatcactgaatgtcccaga
acggattgctattatataacctgttgcaaggcggcgcacctgctgacctggagcatgcca
agaacgggaaacgcagactgcctgcaagcacggatctatgtcggcggaatgaagatcacc
gctctctgcagcctggacaacactagctttgctgcaggaaccgctggaagctatctgcat
tgcgtacaaattatccacgagaataatcagcttagcctgcagacgcaatcgatagccatg
agtgtcctccaggatttccaggtgatgggactgtgcaccagtaggcacaaaaacttaatg
accctgtttctctaccgcaacaaggaatatctgaatgagactgtgtctcaaaagaaccag
ttggttatgcaagtgctcaaggtggggaatcaggatccactgaacagctatcaggcatct
gaaatccaataa

DBGET integrated database retrieval system