KEGG   Drosophila simulans: Dsim_GD13581Help
Entry
Dsim_GD13581      CDS       T01065                                 

Definition
GD13581 gene product from transcript GD13581-RA
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 1051 aa AA seqDB search
YEDELAECGAPPPGAIPMTWTTAMPLPPDAVQPALLPPPPHHILQQTSPLLIEQPAQLVQ
TQPPQPPTPTPQQQEQQAHQEQTADKSLTQNNNEVVALDEKLANEKQQQIEFQQKQQEQL
QQLHQLPQQQQQQEEQQQPQQLQPLQTEKPPTKVPNLVVATVAPQLQTSPVVVSPKQQQQ
QPQAAHQNSYHDQHEQHHLPQQQQPQPQRKPSQQYNQSQQQQVRRKYSSEYNHHHHQHGS
SDTGIQTTKTMSWTNSAQHKKSTQSVSVTASPNSVNNGPGVGAASGPAGKANYSHTTKTF
TNQQHYQQQHYHTQNSYNNNSSGGSSSNSSSSSSNNQPQVRNYGTMKMPSSPVAWAAPTP
ERKNSQQAAAAPAAATASASAAPVAITTVTTSTASITATPNQFQPETGNSSASPAVAAPQ
QQQPAAQQHAQAAQTGAAAAPSKSYSNYAPKKHQSYEPAVLSSVVATSSSANPQPQLNLA
PPAPPASQNSSDSSQLSWASLFASNKPVAKVAPYEASKIAQQQPAHPVLQLAPPQPAQVA
AAAPVAQPSSPPQNLPLPTAHQQSQLPAPVPAPTVPLVTPGALSYSAASAQAVPAPSPAS
ASVKPLKPEPPRPVQQQLDEWTSKYAEYLTRHKTNLAPISLRPRGLTNRSNYCYINSILQ
ALLGCSPFYNLLRSIPKQAAVLSEVKTPTVNAICLFMTNFSSLPSGLRLRLNNLNKGSQS
KGKDEFVGSDLQCDMAFEPTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVI
KLIDKPTPQQNGQEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRL
QREGEHSTDVIQPFFTLQLNIEKAASVKEALEILVGRDQLEGVTGSKTKQEVVAWQQMTL
EKLPVVLILHLKYFDYRSDGCTKILKKVDFPVELKIDAKILGSKKTSQKQRAYRLFAVVY
HDGKEASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYYRRSDTLP
PQQQQTQQQNGGGSGGVVGSSSSSSNAGDNK
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
tacgaggacgagctcgccgagtgcggagcaccgccgccaggcgctattccgatgacctgg
actactgccatgcccctccctccggatgcagtccagccagccctgctgccgccgccgccg
catcacattttgcagcaaacgtcgcccctgttaatcgaacagccagcccagttggttcag
acccaacctccgcagccaccaacacccactccccaacagcaggagcaacaagcacatcag
gagcaaacggctgacaagagtttgacacagaacaacaacgaggtggtggccttggatgag
aagttggccaacgagaagcagcagcaaatcgagttccaacagaagcaacaggagcaacta
cagcagcttcatcaactaccacagcagcagcagcagcaagaagagcagcagcaaccgcag
caactacagccgctacaaaccgaaaaaccgccaacgaaagtgccaaaccttgtagtagct
acagtggcacctcagctgcaaacatcaccggtggtggtgtcgccaaaacagcagcagcag
cagccacaagctgcgcaccagaacagctaccatgatcagcatgagcagcatcatttaccg
cagcagcagcaaccgcagccacagcgcaaaccctcgcagcaatacaatcaatcgcagcag
caacaggtgcgccgtaagtactcctcagagtacaatcaccatcatcaccagcacggcagc
agcgacacgggcatccaaactaccaagaccatgtcctggaccaattcagctcagcacaaa
aagtccacgcagtcggtttcggtcaccgcttctcccaatagtgtaaacaatggacctgga
gtgggtgctgcaagtggaccggcgggcaaagccaactacagccataccactaagactttt
accaaccagcagcattaccagcagcaacactaccacacccagaacagctataacaacaac
agcagcggcggaagcagcagcaacagcagttcgagcagcagcaacaaccagccacaggtg
cgcaactacggcaccatgaagatgccctcttcgccggtggcttgggcagcgccaacgccg
gagcgcaaaaacagccaacaggcagcagcggcaccggcagcagcaactgcgtctgcgtct
gcagctcccgtggcaatcacaacagtaactacctcaacggcaagcattacggctacccca
aatcaatttcaaccggagactggcaacagtagtgcatcaccagccgtggctgccccgcag
caacagcagcctgcagcacagcaacatgcgcaggccgcacaaacaggagcagcagcagct
ccaagcaagtcctacagcaactatgctcctaaaaagcatcagagctatgagccagcagtg
ctgagctccgtggtggccaccagttcgtcagccaacccgcagccgcagctgaatcttgcc
ccacctgcgccaccagcctcgcagaacagcagcgacagttcgcagctttcgtgggctagt
ttgtttgccagcaacaagcccgtggccaaggtggcgccctacgaggccagcaaaattgca
cagcagcagccagcccatccagtgctccaattggctccgccgcagcctgctcaagtggcg
gctgccgccccagttgctcagccgtcgtcgcctcctcagaatttgcccctgcccacggct
caccagcagtcacagttgccagcacctgtgccggcgcccacggttccgctggtcactcca
ggagcgctctcctattctgctgcatccgctcaggcagttcctgctcccagccccgcgtcg
gcatccgtcaagcccctcaagccggaaccgccgcgtcctgtgcagcagcaactggatgag
tggaccagcaagtacgccgagtacctgacgcgccacaagaccaatttggcgccgatcagc
ctgcgtccccgaggactgaccaacaggtccaactactgctacatcaactcgatcctgcag
gccctgctcggctgttcgccgttctacaacctgctgcgctccattcccaagcaggcggct
gtcctgagcgaggtcaaaacgcccactgtgaacgccatatgtctttttatgaccaacttt
tcatcgctgcccagcggtcttcgcctgcgtctgaacaacctcaacaagggatcgcaaagc
aagggcaaggacgagtttgtgggctcagatttgcaatgcgacatggcctttgaacccact
gagatctacaagctgtggaacgacagtcgcgaggagcatgtcgaaggtcgtcaagaggac
gccgaagaattcttgggctacgttctaaacaagctgaacgacgagatgctggaggtgatt
aagctgattgataagcccacaccccagcaaaatggtcaggaacccgcggaaccagaggat
ggaggcgatgtctggcagatgatttgcaacaatcgtaataagggcagcgtaacccgccag
accgacttcggacgcactcccgtaagcgatatcttccggggagaactgcgctcccggctg
cagcgtgagggagaacactccacggatgtgattcagcctttcttcacgcttcaactgaat
attgaaaaagctgcatctgtgaaggaggcactggagatccttgtgggtcgcgatcagctg
gagggagtcacaggcagcaaaaccaaacaggaggtggtggcctggcagcagatgacgctg
gagaaactacccgtcgtcctgatattgcatttaaagtacttcgactaccgctctgatggg
tgcacaaagattttgaagaaggtggatttccctgtggaactaaagatcgatgccaaaatc
ctcggctcaaagaagacctcgcagaagcagcgcgcctatcgcctgtttgcggttgtctat
cacgatggtaaggaggcgtcgaagggccactacatcacggacgttttccacacgggctac
agcagctggctgcgctacgacgacagctcggtgaagccggtcagcgagaagcacgtcctc
cagccgcacacgccccgtgtgccttacctgctgtactatcgccgttcagacaccctgccc
ccgcagcagcagcaaacccagcagcagaatggcggaggatcaggtggagtcgtgggcagc
agctcctcatcatcgaatgccggggataacaagtga

DBGET integrated database retrieval system