KEGG   Drosophila simulans: Dsimw501_GD13594Help
Entry
Dsimw501_GD13594  CDS       T01065                                 

Gene name
Dsim_GD13594
Definition
(RefSeq) GD13594 gene product from transcript GD13594-RA (EC:3.2.1.17)
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dsimw501_GD13594 (Dsim_GD13594)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD13594 (Dsim_GD13594)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 140 aa AA seqDB search
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGW
SAWSTWHYCSGWLPSIDDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcatcgttctggttgccctggctctggccgctcccgctcttggtcgcacc
atggaccgatgctccctggcccgcgagatgtccaacctgggcgttcctcgtgaccaattg
gctcgttgggcctgtattgccgagcacgagtcatcttaccgaaccggagtggtgggtccc
gagaactacaacggctccaacgactacggaatcttccagatcaacaactactactggtgc
gctcctcccagcggtcgcttctcctacaacgaatgtggcctgagctgcaacgccctcctg
accgacgacatcacccactccgtccgttgtgcccagaaggtcctcagccagcagggatgg
tccgcctggtccacctggcactactgcagcggatggttgccgtccatcgatgattgcttc
taa

DBGET integrated database retrieval system