KEGG   Drosophila simulans: Dsim_GD13642Help
Entry
Dsim_GD13642      CDS       T01065                                 

Definition
GD13642 gene product from transcript GD13642-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsi  Drosophila simulans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsim_GD13642
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dsim_GD13642
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsim_GD13642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 553 aa AA seqDB search
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFSASDIVTVGITNQRETTIVW
DAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNV
PEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDTFGIREEMLPTIHSCSEVFGKITSER
SPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGCFLLCNTGDKPVFSRHGLLTTVA
YKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFT
GLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICFQTRDILECMHQECGYEINKLHAD
GKLTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYYENVH
YDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKTREYTEENYRMLSSLPASIFLISS
FAMLVHSLAASGQ
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcaagaacttaccccactccagtgcggatgtgccgttccgcagcaaggag
ctgcgcaagcagtcgctcatccagcacaccggcctggtcggtgtcatcgatgagggcacc
aagaccatcggtttctccatctacaccacgccggacttcaaggagatcgccgcacaccgg
gtggagctgagcgtgatcacgccccaggatggctggtacgagcaggatccgctggagatg
atggcctcgatcaacaagtgcgccgaggaggccatcaagcagctgcccgaacagggtttc
tccgccagcgacattgtcaccgtgggcataaccaaccagcgcgagacgacaatcgtctgg
gatgcggtcaccggcaaaccgctgtacaatgcgctcctgtggaaggacatccgcaccagc
accacagtggagcagatcgtggccaaggtgcaggatccgaaccacttccgcagcagcacg
ggcctgcccatctccacgtacttctcggccctcaagatccgctggctgcgggacaatgtg
cccgaggtgcggcaggccatccgggaaaggcgttgcaaggcgggcacagtcgacagctgg
atcgtctggaacttgacaaacggagctctccacatcacggatacgttcggcatcagagag
gagatgctgcccaccatccacagctgttcggaggtatttggcaagatcacttcggagcga
agtccgctgcgtgggatgaccctgagtggaataatgggcaaccagcaagcctcgcttctg
ggccagatgtgcgtgaagcccggtcagacgaagaacacctaccgatccggctgctttctg
ctctgcaatacgggggacaagccggtcttttccaggcacggtctgctcaccaccgtggct
tacaaactcggtccccaggcaccgacgatctacgccattgagggagctgtgtcggtggcc
ggacatgcgctctcctggctgcaaaacaaggtgcgtatcctgccggactccagagatgcc
gagaaatatgcggagatggtgcccacatcgggggatgtgtactttgtgcccgccttcaca
ggactatatgcaccctactggcggcagaatgctcgcggcatcatcattgggctcacgcag
tttacccgtaagaatcacatagtgagagctgcactggagagcatctgcttccagacgcgc
gacatcctggagtgcatgcatcaggagtgcggttacgagattaacaagctacatgcagat
ggcaagctcaccacaaacaacctgttgatgcaactccaggcggacaccattggtatgccc
gtcttccgctcacagctaatggactctacggccttcggggcagccatgtgcgccgcccag
gcggatggtgtcaatctctgccagttcgaacccgagaagcgatactacgagaacgtgcac
tacgacaccttcctggccaccaccacagatgtagagcgcaaggagcgttacggcaagtgg
aagcgggctgtggagcgcagtttgggatgggtcatcaagcagaagaagacgcgggagtac
acggaggagaactaccgcatgctgtcctcgctgccagcgagcatcttcctcatcagcagc
ttcgccatgctggtgcattccctcgctgcgagtggccagtaa

DBGET integrated database retrieval system