KEGG   Drosophila simulans: Dsim_GD13757Help
Entry
Dsim_GD13757      CDS       T01065                                 

Definition
GD13757 gene product from transcript GD13757-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dsi  Drosophila simulans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dsi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dsi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 196 aa AA seqDB search
MAGRSIVHFFLGSVAIALGSYIYFTMQALRCYSMRRTLGPVLELSRGQRQCLRLCTVLLP
VSCAATPTYATSSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDISLEKYKGKVV
LVVNIASKCGLTKNNYQKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDS
KADIGEVFAKTYLFCE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccggccgctccatcgtccacttttttctggggtccgtggcaatcgccctgggatcg
tacatctacttcaccatgcaagccctcaggtgctactcgatgaggcggaccctgggcccc
gtcctcgagctgagtcgcggtcagaggcagtgccttcgcctctgcaccgtcctgcttccc
gtgagctgtgcggccacgcccacatacgccacctcctcagccgcccagcactccacagca
gctgccatcgacatgtctgctaacggagattacaagaacgccgcctcgatctacgagttc
accgtgaaggacacccatggcaacgatatttcgctggaaaagtacaagggcaaggtggtc
ctggtggtgaacatcgcctccaagtgcggcctgaccaagaacaactaccagaagctgacg
gatctgaaggagaagtacggcgagcgcggcctggtgatcctcaacttcccgtgcaatcag
tttggatcccagatgccggaggccgatggagaggccatggtgtgccacctgcgcgactcc
aaggctgacatcggcgaggtgttcgccaagacttacttattctgtgagtag

DBGET integrated database retrieval system