KEGG   Drosophila simulans: Dsim_GD13835Help
Entry
Dsim_GD13835      CDS       T01065                                 

Definition
GD13835 gene product from transcript GD13835-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dsi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dsi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dsi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dsi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dsi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dsi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 622 aa AA seqDB search
MKWTRTALGVALLLALVSHLAAHSSDDLVYGYECRSGFCHNVELSEENYTEAISLPVCRL
FCGSSIGTLWPKPTGTVRLDTLMRQVDISFIDFNFNGTARQQKLWRAAEDRFMDMLDAQI
PDRKVLARGGYRMSVNINTPDEPTPARLTLDTDESYTLDIDTDASGHVLANITAANFFGA
RHGLETLAQLIVYDDIRREVQVTANATINDAPLYKWRGLLLDTSRNYYSVKSIKRTLEGM
ALVKLNTFHWHITDSHSFPLEVKKRPELHKLGAYSQRQVYTRRDVAEVVEYGRVRGIRVM
PEFDAPAHVGEGWQHKNMTACFNAQPWKSFCVEPPCGQLDPTVNEMYDVLEDIYGTMFDQ
FNPDVFHMGGDEVSTSCWNSSQPIQQWMKKQGWGLETADFMRLWGHFQTEALGRVDKVAN
GTHTPIILWTSGLTEEPFIDEYLNPERYIIQIWTTGADPKVKKILERGYKIIVSNYDALY
LDCGGAGWVTDGNNWCSPYIGWQKVYDNSLKSIAGDYEHHVLGAEGAIWSEQIDEHTLDN
RFWPRASALAERLWSNPAEGWRQAESRLLLHRQRLVDNGLGAEAMQPQWCLQNEHECPID
ACSRGSGRLGLIVLLLLTTLSA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggacgcggactgcacttggagtggccctgctcctggccctggtgtctcacctg
gcggcccacagctcggatgacttggtttacggatacgagtgccgcagtggcttctgccac
aatgtggagctcagcgaggagaactacaccgaggccatcagtctgcccgtgtgccggctc
ttctgcggcagctccatcggcacgctgtggcccaaaccgacgggcactgtgcgtctggac
acgttgatgcgccaagtggacatctccttcattgactttaatttcaatggaactgcccgc
cagcagaagctatggcgagcggctgaagaccgtttcatggacatgctggacgcccagatc
ccagatcgcaaggttctcgctcgtggtggctaccgtatgtctgtgaacatcaatactccg
gatgagccgactccagccagactcaccctggatacggatgagagctatacgctggacatt
gatacggatgcttcgggtcatgtgttggccaacattaccgcggccaacttctttggagcc
cgtcatggtctggagaccctagcccagttgattgtctacgatgacatccgccgcgaggtt
caggtgactgccaatgccaccatcaacgatgccccgctgtacaagtggcgtggattgctc
ctggacacctcccgtaactactactctgtgaagtccatcaagaggacgttggagggcatg
gccttggtcaaactgaacaccttccactggcacatcacggactcgcacagcttcccactg
gaggtgaagaagcgaccggagttgcacaagctgggagcctattcccaacgccaggtgtac
acccgtcgggacgtggccgaggttgtggagtacggccgcgtgcgaggcatccgtgttatg
ccagagtttgatgcccctgcccatgtgggtgagggctggcagcacaagaacatgaccgcc
tgcttcaatgcccagccatggaagtccttctgcgtggagccaccgtgtggccaactcgat
cccactgtgaacgaaatgtacgatgtgctggaggacatttacggcaccatgttcgatcag
ttcaacccggatgtcttccatatgggtggcgatgaagtgtccactagctgctggaacagc
agccagcccatccagcagtggatgaagaagcagggttggggtctggagaccgcagacttt
atgcgcttgtggggacacttccagacggaggctcttggtcgcgtggacaaggtggccaat
ggtacgcacacgccgatcattctgtggactagtggtctcaccgaggagcccttcattgac
gagtatctgaacccagagcgttacatcattcagatctggaccactggtgcagatccgaag
gtaaagaagattctggagcgcggctacaagatcattgtgtcgaactacgatgccctgtac
ttggactgcggcggagctggttgggtgaccgatggcaacaactggtgctcaccctacatt
ggctggcagaaggtgtacgacaacagtttgaaatccattgccggcgactacgagcatcat
gtattgggcgcggagggagccatttggtcagagcagattgacgagcacaccctggacaac
cgcttctggcccagggccagtgccctggccgagcgactttggtcaaatcctgccgagggt
tggcgccaggcggagtcacgtctgctgctccaccgccagcgactggtggacaacgggctg
ggtgcggaggccatgcagccgcagtggtgcctgcaaaacgagcacgagtgtcccattgac
gcatgtagtcggggcagcgggcggcttgggttgatcgtcctgttgctactcacaacgctc
tctgcctga

DBGET integrated database retrieval system