KEGG   Drosophila simulans: Dsim_GD13856Help
Entry
Dsim_GD13856      CDS       T01065                                 

Definition
GD13856 gene product from transcript GD13856-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dsi  Drosophila simulans
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dsim_GD13856
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsim_GD13856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 521 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRTYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSNNNSNNKSDNDAGATANAGSGSGSGFGAGAKGAKENNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcacagcaaaaaacgcgtttgttactactacgacagcgacattggcaactac
tactatggccagggtcatcccatgaagccgcaccgcatacgcatgacccacaacctgctg
ctcaactatgggctctatcgaaaaatggaaatataccgtccccataaagccactgccgat
gagatgaccaagttccactcggacgagtacgtccggttcctgcgatccattcggccggac
aacatgtcggagtacaacaagcagatgcagcgattcaatgtcggcgaagattgtcccgtc
ttcgatggactgtacgagttttgccaactctccgccggaggatccgtagctgcggccgta
aaactgaataagcaagcctcggagatctgcatcaattggggcggtggactgcatcacgcc
aaaaaatcggaggcctcgggcttctgctacgtcaacgacattgtcctgggaattctggag
ctgcttaaataccaccagcgtgttctctacatagatatagacgtgcatcacggcgatggc
gtggaggaggcgttctataccaccgatcgtgtgatgactgtcagcttccacaagtacgga
gagtatttcccgggcaccggcgatctgcgagacattggcgccggcaaggggaagtactat
gcggtgaatatacccctgcgtgatggcatggatgatgacgcgtacgagagcatatttgtg
cccattatcagcaaggtgatggaaacattccagccggcagccgtggtgctgcagtgtggc
gctgattcgctgactggcgatcggttaggttgcttcaatctcaccgtcaagggtcacggc
aaatgcgtggagttcgtgaagaagtataacctgccgttcctgatggtcggcggtggtggt
tataccattcgtaacgtatcccgctgctggacctatgagacctccgtggcactggccgtg
gagatagccaacgaactgccctacaacgattacttcgagtactttggacccgatttcaag
ctgcacataagccccagcaatatgacgaatcagaatacatccgagtacctggagaagatc
aagaaccgtctgttcgagaacctgcgcatgctgccccacgctccgggcgtgcaaatccaa
gcgattcccgaggatgccatcaacgatgagtccgacgacgaggacaaggtcgacaaggac
gatcgcctgccgcagagcgacaaggacaagcgcattgtgcccgagaacgagtactccgat
tcggaggatgagggcgaaggcggtcgcagggataaccggacgtacaagggtcagcgaaag
cggccgcgtctcgacaaggacaccaacagcaacaaggcatcctcagagacgtccagcgag
atcaaggatgaaaaggaaaagggtgacggagctgatggcgaggagtcgacggcgtccaat
acgaatagcaacaacaacagtaacaacaagagcgataatgacgccggagcgacagctaat
gccggatccggatcgggatcaggttttggtgccggggccaagggcgccaaggagaacaac
atttga

DBGET integrated database retrieval system