KEGG   Drosophila simulans: Dsim_GD14038Help
Entry
Dsim_GD14038      CDS       T01065                                 

Definition
GD14038 gene product from transcript GD14038-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD14038
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsim_GD14038
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsim_GD14038
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsim_GD14038
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsim_GD14038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 233 aa AA seqDB search
MASAQVQSLDIIKQQDQQHQLDNINKHHHHHHEGVPLECNSPKPIDEEIYQVEYKHPLEH
VWTLWYLEYNRSKHWKDMLNEITEIDSVETFWSLYHTIKSPAELKSGCDYAVFKKGIKPM
WEDEANIKGGRWLVTVNKSAKAELDKIWLDILLLMVGQNFEYSDEICGAVVNIRSMSNKI
SVWTANGSNEMAILEIGQKLKTLLHMQSRNLQYQLHSDAMCQFNSGVKSVYTL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgcacaagtgcaaagtcttgatataattaagcagcaggatcagcaacatcag
ctggacaatatcaataagcatcatcatcatcaccacgaaggtgttccactggagtgcaac
agcccaaaacctatcgatgaagagatataccaagtcgagtacaagcatcctttggagcat
gtgtggaccctgtggtatttggaatacaatcgctccaagcactggaaggacatgctgaac
gagattaccgagattgatagtgtggagaccttctggagcttgtaccataccatcaagagc
ccagccgagctgaagagtggatgcgattacgccgtgttcaagaagggcataaaacccatg
tgggaggatgaagccaacatcaagggtggtcgctggctggtcaccgtgaataagagtgcc
aaggcggaattggataaaatttggctggacattcttctgcttatggtaggccaaaatttt
gaatactccgacgagatctgcggagctgtcgtcaatatacgtagcatgagcaacaaaatc
tcggtttggactgccaacgggagtaacgaaatggccattctggagatcggacagaagctg
aagacactccttcatatgcaatcgcgtaatttgcagtaccaacttcattcggatgcaatg
tgccaattcaattcgggcgtcaaatcggtttatacactctga

DBGET integrated database retrieval system