KEGG   Drosophila simulans: Dsim_GD14046Help
Entry
Dsim_GD14046      CDS       T01065                                 

Definition
GD14046 gene product from transcript GD14046-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsim_GD14046
   04068 FoxO signaling pathway
    Dsim_GD14046
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsim_GD14046
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dsim_GD14046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 430 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPS
ELPPSPHQWE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcactggtacagggtggtgctgccggtggtgcgccacagggcgcc
agcgcaatcttggccgcagcggctccctactatcaaccgccggctgttccccaggatgtc
cagccggatcgtcccatcggctatggagcattcggagttgtctgggctgtcacagatcct
cgcgatggacgacgagtggccttgaagaagctgccaaatgtgttccaatcgttggtctca
tcgaagcgcgttttccgcgagctgaaaatgctgtgcttcttcaagcatgaaaatgttctt
tcagctctggacattctacagccaccgcatttggatttctttcaagaaatctatgtgata
acggagctgctgcaatcggatctgcacaagataatcgtgtcgccgcagcacctgtccgcc
gaccacatcaaggtgttcctgtaccagatcctgcgcggcctcaagtatctgcactcggcc
cgcatcctgcatcgcgacatcaagcctggcaatctgctggtcaactcgaattgcgtgctc
aagatctgtgactttggattggcccgcgtcgaggagcccgatcaggccaagcacatgacc
caggaggtggtcacccagtactatcgcgcaccggaaattctgatgggcgctcgccactac
tcgtcggcggtggatgtgtggtcggtgggctgcatttttggcgagctgctgggccgtcgc
atcctcttccaggcacagaatcctgtgcagcagctggagctgattaccgagctgctgggc
acgcccaccatggaggatatgcgtcacgcctgcgaaggcgcccgcacccacatgttgcgc
cgggcgcccaagccgccatccttctcggtgctctacacactcagctcgcatgccacgcac
gaggcggtgcacctgctctgccagatgctcgtcttcgatccggacaagcgtatctccgtg
acagatgccctggcgcatccgtatctggatgaggggcgtctgcgctaccactcgtgcatg
tgcaaatgctgcttcactacctcagccggaatgcgtcagtatacggctgattttgagccc
tccgccggccagcccttcgatgatctgtgggaacgcaagctgacatccgtgcagcaggtc
aaagaggagatgcacaagttcattgccgagcagctgcaaacgggtcgtgtgccgctgtgc
atcaatccacagagtgcagccttcaagagtttcgccagttcgactgtggcacatccttcg
gagctgccgccctcgcctcaccaatgggaatga

DBGET integrated database retrieval system