KEGG   Drosophila simulans: Dsimw501_GD14067Help
Entry
Dsimw501_GD14067  CDS       T01065                                 

Gene name
Dsim_GD14067
Definition
(RefSeq) GD14067 gene product from transcript GD14067-RA
  KO
K03259  
translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD14067 (Dsim_GD14067)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsimw501_GD14067 (Dsim_GD14067)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsimw501_GD14067 (Dsim_GD14067)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsimw501_GD14067 (Dsim_GD14067)
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsimw501_GD14067 (Dsim_GD14067)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 244 aa AA seqDB search
MVYTGYLSNGLQNAEDTEWLPYGDPNDWAHGLAAYDGLELMGGNEQEVQPSLNRVMKNID
YDLALKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFND
YMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECFEHSDEICGV
VINVRNKANKLSLWTKDSRNVEAILSIGRQIKDLLHLGVMEIQYQVHNDAMLNHGPNVNA
IYKL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacaccggttacttaagcaacggattgcagaatgctgaggacactgaatggttg
ccgtatggagatcccaatgactgggcacatggtctagcggcttatgatggtttggagctg
atgggcggcaatgagcaggaggtgcagccctctttgaaccgggtgatgaaaaacatcgac
tacgacctggccttgaagcatccattggagcatacctggactttgtggcacttggagaac
gatcgtaccaagcgctgggccgaaatgctcgtcgatgtgaccagcttcaacaccgttgag
gactttttcagtgtgtactactttgtgaagccgccatcggatctgaagatattcaatgac
tacatggtgttcaagaaaaatattcgtcccatgtgggaggatgacaccaacaagaacggt
ggtcgttggatattgctcctggacaaggcctccaggacctatatagataagatgtggcac
gatttgcttttgtgcatgattggcgagtgcttcgagcactcggacgagatatgtggagtg
gtcatcaatgtgcgcaacaaggctaataagctatccctttggacaaaggactcgcgcaat
gtggaggccatcctgtccatcggcaggcagataaaggacctgctgcatctgggcgttatg
gaaatccagtaccaggtgcacaacgatgccatgttgaaccatggacccaatgtcaatgcc
atctacaaattgtag

DBGET integrated database retrieval system