KEGG   Drosophila simulans: Dsimw501_GD14257Help
Entry
Dsimw501_GD14257  CDS       T01065                                 

Gene name
Dsim_GD14257
Definition
(RefSeq) GD14257 gene product from transcript GD14257-RB
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dsi  Drosophila simulans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD14257 (Dsim_GD14257)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dsimw501_GD14257 (Dsim_GD14257)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 239 aa AA seqDB search
MISFLFIVNRALSSSSSSSGSSSISSAAASLTNKKMTAPGPRPLVLCGPSGSGKSTLLKR
LFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGT
SKAAVREIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIKELERRLRKRGSETEE
SLSKRLNAAQVEIDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELEEQQKQGVSVNLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagtagcagcggc
agcagcagcatcagcagtgcagcggcatccttaacgaacaagaagatgaccgcccccggc
ccacgcccccttgtcctgtgcggtccctcgggatccggaaagagtacgctgctcaagagg
ctgttcgccgaattccccagcacctttggcttcagcatatcgcacaccacgcggaagccg
cgtgagggcgaggagcatggggtgcactactactttgtggaacggccggaaatggaggca
gccatcgccggcgacgagttcatcgagacggccgagtttacgggcaatctgtatggaacg
agcaaggcggcggttagggagatccaggcacagggacgggtctgcatactggacatcgaa
cagaagggagttgagcagatccgtcgtactgatctcaatcccatactgatcttcaacaat
ccaccgagcatcaaggagctggagcgacgacttcgcaaacgtggctccgaaacggaggag
tcgctgagcaagcgcctcaatgccgcccaggtggagatcgattatggtttgacgcccggc
aacttccacaagatcatcaacaacgtggacatcgatgtggcctacgaggagttccgcaac
tttgtcgtccaggaactcgaggagcagcagaagcagggagtatcagttaacttgaagtaa

DBGET integrated database retrieval system