KEGG   Drosophila simulans: Dsim_GD14605Help
Entry
Dsim_GD14605      CDS       T01065                                 

Definition
GD14605 gene product from transcript GD14605-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 420 aa AA seqDB search
MSPNSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATTYEWVAWIAQVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGP
PVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQH
FDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLFPKVTRFNIHQ
LLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGEPSIAHS
IILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIAYGGDTYFVRL
NRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEEDPDEDHEKKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaattctatgtggatcttcggcctcataagtgctctgcttctgactctgggt
tcgacggggctatcctcgaaggttttggaacttagtgaccggttcatcgatgtgcgacac
gagggtcaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cctatttttgctctggtggctcaggctctgcatgccaccacgtacgagtgggtcgcctgg
attgcacaagttcgtgggtatcccaccatcatgttcatcaagggcaacatggagttcacc
tacaacggagaccgcggtcgcgatgagctagtggattatgccctgaggatgtctgggcct
cctgttcagctggtcacgcgaacggagagtgtagacatgctaaagggatcccatacaata
tttttcattttcgtgggtcaacaggagggcgtggtgtgggatacatactatgctgcagct
gaaggttaccaagagcatggatttttctatgccaccagcgaggatatcgctgcccagcac
tttgactttgagaaactgccagcagtgatcgtctacaaagaagagcagcaccacttctat
ccgcacggacatttggcacatgaaatggaccccaatgaagtgaacgaaaccgttttccag
tgggtgaacgtggagaggttcacactcttcccaaaggtcactcggttcaacatccaccag
ctgctcaagacaaacaagtacttggtattggctgtggtacaggaggataagctcaatcag
atagccacgcatgagctggagtttcgggacatggtggagggcgtgataagaaagcatagg
gcgcgatatcatgacaaattccaatttggatggattggcgagccatcaatagcacattcc
attatcttggatcaactgcccacgcctcacttgatagcgattaattcgagcacccaacac
cacttcatacccgaagatgatcccatgcaaatgactccacaggcattgcaccttttccta
gaatccatccgcaacgaaagtgcgattgcctatggaggagatacgtactttgtacgtttg
aatcgggcgctgttcgaagtgcgacgagctctaagggatatgtggctgggaaatcccgtg
ctgaccactgtcatcttcggcctgccactgggattcttatcgcttatcatgtactcgata
ttctgcggcgattgcttggtcacagaagaagatcccgatgaagatcacgagaagaaggag
taa

DBGET integrated database retrieval system