KEGG   Drosophila simulans: Dsimw501_GD14605Help
Entry
Dsimw501_GD14605  CDS       T01065                                 

Gene name
Dsim_GD14605
Definition
(RefSeq) GD14605 gene product from transcript GD14605-RB
  KO
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsimw501_GD14605 (Dsim_GD14605)
Chaperones and folding catalysts [BR:dsi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dsimw501_GD14605 (Dsim_GD14605)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 430 aa AA seqDB search
MSPNSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIA
YGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPDEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaattctatgtggatcttcggcctcataagtgctctgcttctgactctgggt
tcgacggggctatcctcgaaggttttggaacttagtgaccggttcatcgatgtgcgacac
gagggtcaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cctatttttgctctggtggctcaggctctgcatgccaccaacgtacgagtgggtcgcctg
gattgcaccaagtatccggcggcagcaaaggaattcaaggttcgtgggtatcccaccatc
atgttcatcaagggcaacatggagttcacctacaacggagaccgcggtcgcgatgagcta
gtggattatgccctgaggatgtctgggcctcctgttcagctggtcacgcgaacggagagt
gtagacatgctaaagggatcccatacaatatttttcattttcgtgggtcaacaggagggc
gtggtgtgggatacatactatgctgcagctgaaggttaccaagagcatggatttttctat
gccaccagcgaggatatcgctgcccagcactttgactttgagaaactgccagcagtgatc
gtctacaaagaagagcagcaccacttctatccgcacggacatttggcacatgaaatggac
cccaatgaagtgaacgaaaccgttttccagtgggtgaacgtggagaggttcacactcttc
ccaaaggtcactcggttcaacatccaccagctgctcaagacaaacaagtacttggtattg
gctgtggtacaggaggataagctcaatcagatagccacgcatgagctggagtttcgggac
atggtggagggcgtgataagaaagcatagggcgcgatatcatgacaaattccaatttgga
tggattggcgagccatcaatagcacattccattatcttggatcaactgcccacgcctcac
ttgatagcgattaattcgagcacccaacaccacttcatacccgaagatgatcccatgcaa
atgactccacaggcattgcaccttttcctagaatccatccgcaacgaaagtgcgattgcc
tatggaggagatacgtactttgtacgtttgaatcgggcgctgttcgaagtgcgacgagct
ctaagggatatgtggctgggaaatcccgtgctgaccactgtcatcttcggcctgccactg
ggattcttatcgcttatcatgtactcgatattctgcggcgattgcttggtcacagaagaa
gatcccgatgaagatcacgagaagaaggagtaa

DBGET integrated database retrieval system