KEGG   Drosophila simulans: Dsimw501_GD14879Help
Entry
Dsimw501_GD14879  CDS       T01065                                 

Gene name
Dsim_GD14879
Definition
(RefSeq) GD14879 gene product from transcript GD14879-RB
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6738836
NCBI-ProteinID: XP_002085636
UniProt: B4QRX5
Position
3L
AA seq 376 aa AA seqDB search
MRILCVIVILLRLGALGDIAADEEGRSTRSWWDVVPRLLTDIATIKANILTAAPLEWASN
IIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
ILATGWTNTVNESSAISMISKAFMCRADVNFVIVDAADYVDTFYAWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKIL
PGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCLTIGCSHTRAVEYFAE
SAYPHQEKNFMGKKCASWDELRKRDCTPSIVSPMGYRMNPQARGMYYVDVNGWPPYGRNS
ENTIDPRLKTCYLCQR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaggattctgtgtgtcattgttatcctcttacgcctcggagcattgggagacatagct
gctgacgaggagggcaggtcgacgagaagctggtgggatgtagtgcctcgacttttgact
gacatcgctaccattaaggcgaacatactcacagctgctccactcgaatgggcctccaac
ataattgatgctgtgtgttcctccaccctctttatggacagaatccctgcgcaaatcact
ccggacataaggaagatgcattttcagtacatgacgccgtgccagaactacagtgtgcca
ctgctggaggcctcgaagctgtggaagcactctcggttcagcaagggacgtaaggtggta
attctggccaccggatggacaaacactgtaaacgaatcctcggccatttcgatgatctcc
aaggcattcatgtgtcgtgccgatgtgaattttgtgattgtagatgcggctgactatgtg
gacaccttctacgcgtggtcggcgctgaacacggacttaattggcgagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgaaatatccacttgattggacattca
ttaggagctcacattatgggcactgctggtcggacctttaagaagcttaccggaaaactt
atacccaggataactggcttggatccggccaagccatgtttcaggcgggaaaagattctg
cctggactgacgcgtggcgatgccaagctagtggacataatccacaccaacattggtatc
ttggccaagcgtggacccctcggggatgtggacttctatccaggcggagcacatcccatc
cagccgggctgcctaaccatcggatgctctcatacccgagccgttgagtatttcgccgag
agtgcatatccacaccaggagaagaacttcatgggcaagaagtgcgcttcttgggatgag
ctaagaaaacgtgattgtacacctagcatagtttccccgatgggctatcgaatgaatccc
caagccaggggcatgtactacgtagatgtcaatggctggcccccttacggccgaaactcg
gagaacactattgatcctagactaaaaacttgctatctgtgccagaggtga

DBGET integrated database retrieval system