KEGG   Drosophila simulans: Dsimw501_GD14936Help
Entry
Dsimw501_GD14936  CDS       T01065                                 

Gene name
Dsim_GD14936
Definition
(RefSeq) GD14936 gene product from transcript GD14936-RA (EC:6.3.5.4)
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dsi  Drosophila simulans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dsimw501_GD14936 (Dsim_GD14936)
Enzymes [BR:dsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dsimw501_GD14936 (Dsim_GD14936)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C44
   Dsimw501_GD14936 (Dsim_GD14936)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3L
AA seq 559 aa AA seqDB search
MCGIFAIFSRNGETIPAQILHGSKHTLRELAYRQSGKQRHRGPDSTGVYVIPSEGVAMVH
ERLRIVGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPKSDCHVILELY
QDYGKDLLQYITGMFAFALYDRTTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKCLVD
TCSKVETFTPGEARFGKVGDLKTCWQFQESWIKEVPTQTCDLSLLRANLESAVRSHLQCD
VHLGALLSGGVDSSLIASIATKIMRERDPNFRLKTFSVGLKDAPDFQAARSVAKYIDSDH
KEIIFEIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPSYDDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPEDKIPGPLNKFGEVQQKRLEKYVLRAAFADNYLPDEVLWRQKEQFSDGVGYDWIDSI
RRVATSHVSDEEFSAAALRFPFNTPTTKEAFYYRCIFDEQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQVNKDC
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgccatattttcgaggaatggggagacgatacccgcgcaaatcctc
catggcagcaagcacactttaagggaactggcctatcgacagagtggcaagcagcggcat
cgtggtccggattccacgggcgtctatgtgattccctctgaaggagtggccatggttcat
gaacgcctgcgaatcgttggcgtggaaatgggcgaccagcctttcgtctctgaggatggt
aacctcatcctggtggccaacggagagatctacaactatctggagctttcggctgagatt
gcgaaaaagcgtggctcctacaaccccaagagcgattgccacgtgatactggaattgtac
caggattatggaaaggatcttctgcaatacatcaccggaatgtttgcttttgccttgtac
gataggacgaccaaggaagtgcttcttgcccgagacccctttggcattatacccatgtat
gtgggtgaggatgcgtcgggaaacctttgggtggcctcggagatgaagtgcctggtggat
acctgctccaaagtggagactttcacacctggcgaggctcgtttcggtaaagttggtgac
cttaaaacatgctggcagttccaggagtcttggatcaaggaggtgcccacgcaaacctgc
gacttgtcgctactgcgagccaacttggagtctgccgtgcgcagtcatctgcagtgcgat
gttcacctgggagccctgctgtccggcggagtagattccagtcttatagcctccatagcc
acgaagataatgcgcgaacgggatcccaacttccgtctgaaaacattctctgtgggtcta
aaggatgcacccgacttccaggcggccaggagtgtggccaaatatatagacagcgatcac
aaggagatcatattcgagatcgacgaagctctggatggcattagggatattgtctaccac
ctggaaacctatgatgtgaccaccgtgagatgtagtttgccgatgctgttactggctaga
tatatcaagagcaccggcatcaagatgatcctctccggcgaaggagccgatgagatcttt
ggaggatatttatacttccacaaggccccaagctacgacgatttccacgaggagctggtg
aagagagtgcgccaactgcatttatccgattgtttgcgggccaacaaggtggccatggcc
aagggcgtggagctgcgagtgccctttctggacacgggattcgttaaccatgtgatgcaa
atccggccggaggataagatacccgggccccttaacaaattcggggaagtacagcaaaaa
cgattggagaagtatgtccttcgagctgcctttgcggataactatctgcccgatgaagtc
ctctggcgccagaaggagcagttctccgacggagtgggctacgattggatcgacagcatc
cgccgggtggccaccagccatgtcagcgatgaagaattctccgcagccgccctacgcttt
ccctttaacacgcccaccaccaaggaggccttctactatcgctgcattttcgacgaacaa
ttccccggagaatcggcagcccgaaccgtggtcagatgggtgccacgcctcgattggggc
tgtccggaggatccatccggaagggcgcaggccgtccaccaggtcaacaaagactgctag

DBGET integrated database retrieval system