KEGG   Drosophila simulans: Dsim_GD14982Help
Entry
Dsim_GD14982      CDS       T01065                                 

Definition
GD14982 gene product from transcript GD14982-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD14982
   00052 Galactose metabolism
    Dsim_GD14982
Enzymes [BR:dsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dsim_GD14982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 370 aa AA seqDB search
MSITLEEEIFGLAVNPFTKSPEMVRRYTLKNSKGMTVSVIQLGAIIQSVCLPDAYKKVDD
VCLGFDDIASYLANKGAYIGGTLGRVANRVANGEYTFNDTKVSVTKNIQDKFQLHGGFIG
FDSVIWEVVQKSAEGVIFRHVSPHGHEGYPGKLTCLITYQLDNENRLWVRYEATTDRSTM
VNLSSHAYFNLAGHGSGAKGLSEHTVEIASDQIVDTDELQIPTGKLVDVNDTVFDLRLPV
LMRDRLMQFENRQIKGYDNCFVVNGGRVQKSVAKVAKIVHPPSCRVLEVWTDQPGMQFYT
ANNLTSIVGKNCTKYEKHGSFCVETEKFPDAMNHPEFPSISLEPNEKYRHDVLYWFKVEE
SWKCCCNNDP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaccctagaggaggagatcttcggcttggccgtgaacccgttcacaaagtcg
ccggaaatggtgcgccgatacacgctcaagaactccaagggcatgaccgtgtcggtgatc
caactgggggccatcatccagagcgtctgcttgccggacgcctacaagaaggtggatgac
gtgtgcctcggcttcgacgacatcgccagctacttggccaacaagggagcctatatcgga
gggaccctcggacgagtggccaaccgagtggccaatggcgagtatacgtttaacgacacg
aaagtctcggtgacaaaaaatatccaggacaaattccagctgcacggtggcttcattgga
ttcgatagcgtcatatgggaggtggtacagaagtcggccgagggagtgatattccggcac
gtatcgccccacggccacgagggctatccgggcaagctgacgtgcctcatcacctaccag
ctggacaacgagaatcgtttgtgggtcaggtacgaggccaccacagatcgctccaccatg
gtcaacctgtcgagccacgcctacttcaacctggcgggacacggatccggagcgaagggt
ctttccgagcacacggtggagattgcgtccgatcagatcgtggacacggacgagctgcag
atccccacggggaagctagtcgacgtcaatgacaccgtctttgatctcaggctgccggtt
ctgatgcgcgaccgactcatgcagttcgagaatcgtcagatcaagggctacgacaactgc
ttcgtggtcaacggaggacgtgtgcaaaaaagtgtagccaaggtggctaagatcgtgcat
ccgccatcttgccgggtactggaggtttggaccgaccagcccggcatgcagttctacacc
gcgaacaatctgacctcgatagtgggcaaaaattgcactaagtatgagaagcacggctcc
ttctgcgtggagacggagaagttccccgatgccatgaaccacccggagttcccttcgatc
agcctcgagccgaacgagaagtatcggcacgatgtcctctactggtttaaggtcgaggag
tcctggaagtgctgttgcaacaacgatccataa

DBGET integrated database retrieval system