KEGG   Drosophila simulans: Dsim_GD15002Help
Entry
Dsim_GD15002      CDS       T01065                                 

Definition
GD15002 gene product from transcript GD15002-RA
Orthology
K06634  
cyclin H
Organism
dsi  Drosophila simulans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dsim_GD15002
  Replication and repair
   03420 Nucleotide excision repair
    Dsim_GD15002
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dsim_GD15002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMEFRVEQNSKYIELHEEEAQGRDLNEHFLTSAEERLLLKQY
EIYLFDFCRRFEPPMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP
DRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccgtgagctcgcagaaaaggtcctggacattcgccaatgagggccagctcatg
gagttccgcgtggagcagaacagcaagtacatcgagttgcacgaggaggaggcgcagggt
cgcgacctcaatgagcactttctcacgtcggcggaggagcgcctgttgctgaagcagtac
gagatctacctgttcgacttctgccgccgcttcgaaccgccgatgcccaagtgcgtggtg
ggcacggccttccactacttcaagcggttctatctgaacaactcccccatggactatcac
cccaaggagattctagccacatgtgtgttcgttgcctgcaaagtggaggagttcaacgtg
tccatcaaccagttcgtgaacaacatcaagggcgacaggaacaaggccacagacatagtg
ttgtccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgagggcttcctgatagatataaaaactcgcagcaatatgcagaatcca
gatcgtctgcggccacacattgatagttttatcgattccacatactactcggatgcttgt
cttctgcatacgccttcgcaaattgcattggctgccgtcctccacgcggccagcagagag
caagagaatctcgatagttatgtgacggatcttctctttgtctccgccagagagaagcta
cccggactcatagatgccgtgcgaaaaattcgcataatggtgaagcaatatcagcagccc
gatcgggaaaaggtcaaggccatcgagaagaagttggacaagtgccgaaatcaagcgaat
aaccctgatagcgaactctataaggagcgcctacgccgattgtacaccgatgaggatgac
atgcccgccgaagatgcctcattccacattgcagatgtgagctcggacacatctgctatg
aacatcagccaatag

DBGET integrated database retrieval system