KEGG   Drosophila simulans: Dsimw501_GD15014Help
Entry
Dsimw501_GD15014  CDS       T01065                                 

Gene name
Dsim_GD15014
Definition
(RefSeq) GD15014 gene product from transcript GD15014-RB
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dsi  Drosophila simulans
Pathway
dsi00330  Arginine and proline metabolism
dsi01100  Metabolic pathways
dsi01230  Biosynthesis of amino acids
Module
dsi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsimw501_GD15014 (Dsim_GD15014)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Dsimw501_GD15014 (Dsim_GD15014)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dsimw501_GD15014 (Dsim_GD15014)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 6739088
NCBI-ProteinID: XP_016032929
UniProt: A0A0J9S007
Position
3L
AA seq 776 aa AA seqDB search
MLQNSFKLAQSLRIGFSRNAWRALSSHGPRQPLVSPERRLEKAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLK
NLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASANGLLLKGGKEAAHSNKALMELVKEALATVGAELAVSLVSTREEISDLLSMENHIDL
IIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLEKALRIARDAKCDYPAACNA
METLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECC
IEVVPSLDEAINHIHTYGSSHTDVIVTENDAAAKQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETLPLD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacagtttcaagctggcccagagcctccgaatcggattctccagaaacgcc
tggcgagcgttgagctcccacggaccccgccagccactggtgtcgccggagcggcgcttg
gaaaaggcgcatcccaccttcacggaaaggagtcagttgaagtacgcccggaggctggtg
gtcaagttgggcagtgcagtcattactcgagaggacaaccatggactagcactcggccga
ctggcgtctattgtggagcaggttgccgagtgccatttggagggacgtgaggtgatgatg
gtcaccagcggagcggtggccttcggaaagcagaagctcgcccaggagctgctcatgtcg
ctgtccatgcgggagaccctgaacccaaaagatagcaaagagttcgacggcgccacgctg
gaaccgcgagcggcggctgcggtgggtcagtcgggtctgatgtccctctacgacgcgatg
tttgcccagtacggagtcaagatagcccaggtgctcgtgaccaagccggacttctacaac
gaggagacacgcaacaatctcttctgcacgctctccgaattaattagcctgaatattgtg
ccaatcataaatactaacgacgccgtctccccgccgatgttcatacgtgacgacgagcca
gccggcggagccaggaggggtattcccattaaggacaacgacagcttgtctgccatgctg
gccgccgaggtgcaggctgatctgctaatcctgatgtcggacgtcgatggtatctacaat
aagccgccgtgggaggacggggcgaagctgatgcacacctacaccagcgacgacagcaac
agcatcgagtttggcaaaaagtcaaaggtgggtactggcggcatggactccaaggtgaag
gcggccacctgggccctggaccggggcgtcagcgtggtcatctgcaacggaatgcaggag
aaggccatcaagaccataattggcggccggaaggtgggcaccttcttcacggaggccacc
gagagcgccaatgcagtgcccgtcgaggtgatggccgagaacgcacgaaccgggagtcgc
cagatgcaagccctcacgcccgctcagagggccagtgctgtcaacaccctggccgatctg
ctggtgagccgcgaaaagtttatcctggacgccaatgccaaggacctggccgaggcgcaa
aagagcggactggccaagccgttgttgtcgcggctttcgctcaacccggccaagctaaag
aacctctccgttggcctgaagcaaatcgccgaggacagtcacaagaatgttggccgtgtc
ctaagacgcacccgccttgcggatcagctggagctcaagcaggtcaccgtgcccataggc
gtcctgctggtcatcttcgaatcccgtccagactcgctgcctcaggtggccgccttggca
atggcctcggccaacggactgctcctcaagggcggcaaggaggcggcacacagcaacaag
gctctcatggagctggtcaaggaggcgctggccaccgttggagcggagctcgctgtctca
ctggtttccacgcgcgaggagatcagtgatctgctgtccatggagaaccacatcgacctg
atcatccctcgcggctcctccgacttggtgcgcagcatccagcagcagtcgctgcacatc
cccgtgctgggccacgccgaaggcgtctgccacgtctatattgacagggatgcggatctg
gagaaggccctgcgcattgcacgcgacgccaagtgcgactatccggctgcctgcaacgcc
atggagaccctgctgatccatgaggacctgatgagtggcgcaatcttcggcgatgtctgc
aacatgctgaaacgtgagggcgtcaaaatctatgccggaccccggctgaaccagcagctg
acctttggcccgccggcggccaagagcctgaagcacgagtacggcgccctcgagtgctgc
atcgaggtggtgcctagcctggacgaggccattaatcacatccatacgtacggcagcagc
cacacggatgtcattgttacggaaaatgatgcggcggccaagcagttcctgggcagcgtg
gacagcgcctgtgtgttccacaacgccagctcccggttcgcggacggcttccggttcggc
cttggcgccgaggtgggcatctccaccgccaggatccacgcccgcgggccagtgggcgtg
gaggggctgctgaccaccaagtggatcctcgaggggcaggaccacgccgccgccgacttt
gccgagggaggtggccgcacgtggctgcacgagaccctgccgttggactaa

DBGET integrated database retrieval system