KEGG   Drosophila simulans: Dsim_GD15159Help
Entry
Dsim_GD15159      CDS       T01065                                 

Definition
GD15159 gene product from transcript GD15159-RA
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 300 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTA
KEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
HAEKQVKRLQKEVDRLEGMYPSPCAPGTSTQPFSAEVSLTGHRRCCPPEVIRSTADRWLH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataacgccattgac
aaggccgacacctgcgagaaccaagccaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggtggagatcgatctggtcaccgcc
aaggagcagctggagaaggccaacaccgagctggaggagaaggagaaactcctgaccgcc
accgagtccgaggtggccacccagaaccgcaaggtgcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggcc
gatgagaacaaccgcatgtgcaaggtgctggagaaccgttcccagcaggatgaggagcgc
atggaccagctgaccaaccagctgaaggaagcccgcatgctggctgaggatgccgatacc
aagtccgacgaggtctcccgcaagctggccttcgttgaagacgagctggaagtggctgag
gatcgcgtccgctccggcgagtccaagatcatggagctggaggaggagctgaaggttgtc
ggcaactccctgaagtccctggaggtgtccgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccatcaagttgaaggaggccgagcagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagagggtatgtat
ccaagtccctgcgcccctggcacatccactcagccattttccgcggaggtatctctcacg
ggacaccggagatgctgtccaccggaagtgatccgctcgacggccgatcgctggcttcac
taa

DBGET integrated database retrieval system