KEGG   Drosophila simulans: Dsimw501_GD15159Help
Entry
Dsimw501_GD15159  CDS       T01065                                 

Gene name
Dsim_GD15159
Definition
(RefSeq) GD15159 gene product from transcript GD15159-RC
  KO
K10374  
tropomyosin 2
Organism
dsi  Drosophila simulans
Brite
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Dsimw501_GD15159 (Dsim_GD15159)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTA
KEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
HAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataacgccattgac
aaggccgacacctgcgagaaccaagccaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggtggagatcgatctggtcaccgcc
aaggagcagctggagaaggccaacaccgagctggaggagaaggagaaactcctgaccgcc
accgagtccgaggtggccacccagaaccgcaaggtgcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggcc
gatgagaacaaccgcatgtgcaaggtgctggagaaccgttcccagcaggatgaggagcgc
atggaccagctgaccaaccagctgaaggaagcccgcatgctggctgaggatgccgatacc
aagtccgacgaggtctcccgcaagctggccttcgttgaagacgagctggaagtggctgag
gatcgcgtccgctccggcgagtccaagatcatggagctggaggaggagctgaaggttgtc
ggcaactccctgaagtccctggaggtgtccgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccatcaagttgaaggaggccgagcagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaggacgagttg
ggcatcaacaaggacaggtacaagtccctggccgacgagatggactccacattcgccgag
ttggctggctactaa

DBGET integrated database retrieval system