KEGG   Drosophila simulans: Dsim_GD15165Help
Entry
Dsim_GD15165      CDS       T01065                                 

Definition
GD15165 gene product from transcript GD15165-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dsi  Drosophila simulans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dsi03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 164 aa AA seqDB search
MQLAGSVDQPPVVHPKRPVTGLDCRIEEPSGVRLWELFLRLAGNMQTFSQQCFVHNFCPL
AFFGADGKNITPSEIRGTYKKQLGDLCLQTLEEQLKLLQPEVIVAVGEYVHSALKRSGYG
KSSSVSVLRLPHPSPRSANNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggcgggttcggtggaccaacctccagtcgttcatcccaaacgtcctgtcact
ggcttggattgtcgtattgaggagcccagtggtgtccgtttgtgggagctgttcctccga
ctggctggcaacatgcagaccttctcccagcagtgtttcgtccacaatttctgtccgcta
gctttcttcggcgcagatggcaagaacataacgcccagtgaaatcagaggaacttacaaa
aagcagctaggagacctgtgcttgcaaaccctggaggaacaactaaagcttctccaaccc
gaagtgattgtggccgttggggagtatgttcacagcgcactaaagcgatcaggatatggc
aaatccagttccgtttcggtgctccgactgccgcatcctagtccgcgttcagctaataat
accaattggcccgagaaggctcaagcgtttttggaggagcacaacctaatccgtttcatg
cggaatgaggcttga

DBGET integrated database retrieval system