KEGG   Drosophila simulans: Dsim_GD15165Help
Entry
Dsim_GD15165      CDS       T01065                                 

Definition
GD15165 gene product from transcript GD15165-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dsi  Drosophila simulans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dsim_GD15165
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dsim_GD15165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 164 aa AA seqDB search
MQLAGSVDQPPVVHPKRPVTGLDCRIEEPSGVRLWELFLRLAGNMQTFSQQCFVHNFCPL
AFFGADGKNITPSEIRGTYKKQLGDLCLQTLEEQLKLLQPEVIVAVGEYVHSALKRSGYG
KSSSVSVLRLPHPSPRSANNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggcgggttcggtggaccaacctccagtcgttcatcccaaacgtcctgtcact
ggcttggattgtcgtattgaggagcccagtggtgtccgtttgtgggagctgttcctccga
ctggctggcaacatgcagaccttctcccagcagtgtttcgtccacaatttctgtccgcta
gctttcttcggcgcagatggcaagaacataacgcccagtgaaatcagaggaacttacaaa
aagcagctaggagacctgtgcttgcaaaccctggaggaacaactaaagcttctccaaccc
gaagtgattgtggccgttggggagtatgttcacagcgcactaaagcgatcaggatatggc
aaatccagttccgtttcggtgctccgactgccgcatcctagtccgcgttcagctaataat
accaattggcccgagaaggctcaagcgtttttggaggagcacaacctaatccgtttcatg
cggaatgaggcttga

DBGET integrated database retrieval system