KEGG   Drosophila simulans: Dsimw501_GD15165Help
Entry
Dsimw501_GD15165  CDS       T01065                                 

Gene name
Dsim_GD15165
Definition
(RefSeq) GD15165 gene product from transcript GD15165-RB
  KO
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dsi  Drosophila simulans
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dsimw501_GD15165 (Dsim_GD15165)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dsimw501_GD15165 (Dsim_GD15165)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Dsimw501_GD15165 (Dsim_GD15165)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 280 aa AA seqDB search
MLKRKLNQQKGNLEIGEPTKTIPRQDSTSEFFDKPLWLKFYETEVGLNEALEKLPPPERA
PFIYNPIVYASQLHRDYLRRYIDGTKKLVFVGMNPGPNGMAQTGIPFGNVRTVKVLMQLA
GSVDQPPVVHPKRPVTGLDCRIEEPSGVRLWELFLRLAGNMQTFSQQCFVHNFCPLAFFG
ADGKNITPSEIRGTYKKQLGDLCLQTLEEQLKLLQPEVIVAVGEYVHSALKRSGYGKSSS
VSVLRLPHPSPRSANNTNWPEKAQAFLEEHNLIRFMRNEA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaaactaaaccagcaaaaaggcaatctggagattggggagcctaccaag
acaatcccaaggcaggacagtacatccgaattcttcgataagccgctgtggcttaaattc
tacgaaaccgaagtcgggttaaatgaggctttggaaaaactgcctcctcctgagcgcgcc
ccgttcatctacaacccgatagtatatgcgtctcagctgcaccgcgactatttgcgtcgt
tatattgacggtaccaagaagctggtatttgttggcatgaatccagggcccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacagtaaaggtcttaatgcagctggcg
ggttcggtggaccaacctccagtcgttcatcccaaacgtcctgtcactggcttggattgt
cgtattgaggagcccagtggtgtccgtttgtgggagctgttcctccgactggctggcaac
atgcagaccttctcccagcagtgtttcgtccacaatttctgtccgctagctttcttcggc
gcagatggcaagaacataacgcccagtgaaatcagaggaacttacaaaaagcagctagga
gacctgtgcttgcaaaccctggaggaacaactaaagcttctccaacccgaagtgattgtg
gccgttggggagtatgttcacagcgcactaaagcgatcaggatatggcaaatccagttcc
gtttcggtgctccgactgccgcatcctagtccgcgttcagctaataataccaattggccc
gagaaggctcaagcgtttttggaggagcacaacctaatccgtttcatgcggaatgaggct
tga

DBGET integrated database retrieval system