KEGG   Drosophila simulans: Dsimw501_GD15356Help
Entry
Dsimw501_GD15356  CDS       T01065                                 

Gene name
Dsim_GD15356
Definition
(RefSeq) GD15356 gene product from transcript GD15356-RA
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dsi  Drosophila simulans
Pathway
dsi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsimw501_GD15356 (Dsim_GD15356)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dsimw501_GD15356 (Dsim_GD15356)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 6739305
NCBI-ProteinID: XP_002076214
UniProt: B4NS61
Position
2R
AA seq 170 aa AA seqDB search
MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacatcactgcccatggaaatgtgttccaatttcgacgccgacgagatc
cggcggctgggcaaacgtttccggaaactggacctggacaactcgggcgcgctaagcgtg
gacgagttcatgtcgctgccggagctgcaacagaatccgctggtgcagcgcgtgatcgac
attttcgacgcggacggcaacggcgaggtggacttcaaggagttcatccagggcgtgtcg
cagttcagcgtcaagggcgacaagctgtccaagctgcgcttcgccttccgcatctacgac
atggacaacgatggctacatttccaatggcgaactgtttcaggttttaaagatgatggtg
ggcaataatctgaaggacacgcaactgcagcagattgtggacaagacgatcggcttcgcg
gataaggatgaggatggcaagatctcgttcgatgagttctgctctgtggtcggcaacacg
gacattcacaagaagatggtagtcgatgtctaa

DBGET integrated database retrieval system