KEGG   Drosophila simulans: Dsimw501_GD15658Help
Entry
Dsimw501_GD15658  CDS       T01065                                 

Gene name
Dsim_GD15658
Definition
(RefSeq) GD15658 gene product from transcript GD15658-RA
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsimw501_GD15658 (Dsim_GD15658)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dsimw501_GD15658 (Dsim_GD15658)
Membrane trafficking [BR:dsi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    Dsimw501_GD15658 (Dsim_GD15658)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 911 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSGGSVDAAQGSGSGGGRQRHAPLYGRFVDAEDLPA
THRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAKKK
RRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVK
AYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLC
LVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILL
CNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMH
TGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGRKY
KPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQ
HNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGVGGGLGTSNSSSGAVSSSSA
AAPTAATAAATAAGSSGSGSSVGGGSSAAQQQQAMPLPLPLPLPLPPLAGPGGASDGQCH
GLLMHSAAANAMNNFSALSLQSNAHPPPSLANSHHSTNSLGSLNHISPGSSGCHNNNSSS
SNNNTRHSRLYGSNMVNMVGHHNSSSNNHNSISYPHAMECDPPQMPPPPPNGHGRMRVPA
IMQLQPNSFAPNSVPYYGNMSSSSVAAAAAAAAAAASHLMMTDSSVISASAAGGGQGGGN
PGQNPVTPSAAAFLFPSQPAGTLYGTALGSLSDLPLPMPLPMSVPLPLPPSSSSSVSSGS
AAVGSGGVGVGVGVGVVGQRRHITGPAAQVSISQSVGSGSSGSATGASSSDASSSSPMVG
VCVQQNPVVIH
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaactg
tccgcttatgggtccagcgggggcagcgtcgacgcagcgcagggcagcggaagcgggggc
ggaagacagcgccacgcccccctctacgggcgattcgtcgacgcagaggatctgcctgcc
acgcaccgggatgtcatgcaccatcactctagtccctcgtcttcgtcggaggtgcgcgcc
atgcaggcccggattcccaaccactttcgggagcccgcctcgggacctttgcgcaagctg
agtgtcgatctgataaagacctacaagcacatcaacgaggtttactatgcgaaaaagaaa
cgtcgtgcccagcagacgcaaggagacgacgactcatctaacaaaaaggagcgaaaactt
tataacgacggctacgacgacgataatcacgactatataatcaagaatggcgaaaagttt
ttggatcgctacgagatcgactctctgatcggcaaaggcagttttggccaggtggtgaag
gcttacgaccacgaggagcagtgccacgtggcgatcaagataattaagaataagaaaccg
ttcctaaaccaggcacagatcgaggtcaagttgctcgagatgatgaatcgggcggatgcc
gaaaacaaatactacatcgttaagctcaagcggcacttcatgtggcgcaaccacctgtgc
ctggtgttcgagctgctctcatacaacctgtacgacctgctgcggaacaccaacttccgg
ggcgtttcgctgaacctcacgcgcaagttcgcccagcagctgtgcaccgcactgctcttc
ctcagcacccccgaactgaacataattcactgtgatttgaagcccgagaacatcctgctg
tgcaacccgaagcgctcggcgatcaagatcgttgactttggcagctcctgccagttggga
cagcggatctaccactacatccagtcgcgcttctaccgctcgccggaggtgctgcttggc
atccagtatgacctggccatcgacatgtggtcactgggctgcatcttagtcgagatgcac
accggcgagccgctcttctccggctgcaacgaggtggaccagatgaacaagatcgtcgag
gtgctgggcatgccgcccaagtatctgctcgaccaggcgcacaagacccgcaagttcttc
gacaagatcgtcgccgatggctcctatgttctgaagaagaatcagaacggcaggaagtac
aagccaccaggatcccgcaagcttcacgacatcctcggagtggaaacaggcggtccaggc
ggcaggcgtctcgatgagccgggccactctgtctcagactatctgaagttcaaggatctg
atcctgcgcatgctcgactttgaccccaagacacgggtcacgccctactatgccctgcag
cacaacttcttcaagcgcacggcagacgaggcaaccaacacgagcggcgcgggcgccaca
gcgaacgcaggagccggtggctccggttccagcggagcaggaggctccagcggcggaggc
gtcggcggcggcctcggaacgagcaacagcagtagcggtgcggtctcctcatccagtgca
gcggctccaacggcggcgacagcagcggccacggccgcaggatcgtccggttcgggttca
agtgtcggcgggggatcctccgcagcgcagcaacagcaggcgatgccgctgccattgccg
cttcccttgccgttgccaccactcgcgggtcctggcggtgcgtcagatggccaatgtcac
ggcctgcttatgcattcggcggcggccaacgcgatgaacaacttctccgctctgagcctg
cagtccaacgcccatccgccgccatcgctggccaatagccaccacagcaccaacagtctg
ggcagcctgaatcacatcagtcccggcagctccggctgccacaacaacaacagcagcagc
agcaacaacaacacacgccacagtcgtctgtacggcagcaacatggtgaacatggtgggc
caccacaacagcagcagcaacaaccacaacagcatcagctatccgcacgccatggaatgt
gatccgccgcagatgccgccaccgccgccaaacggacacggcaggatgcgagtgccggcg
ataatgcagcttcaaccgaacagctttgcgcccaattcggtgccctattacggcaacatg
tcctcgtcgtcggtggctgcggcggcggcagcggcagcagctgctgcctcgcacctaatg
atgaccgattcgagtgtgattagcgcctctgcggcgggcggtggccagggtggcggcaat
cccggccagaatccggttacgccgtcagctgccgcctttctcttcccatctcagcccgcc
ggaacgctctatggcacggcgctcggttcgctgagcgacctgccactgccgatgccactg
cccatgtccgtgcccctgccactgccgccctcgtcgtcgtcgtccgtctcctcaggatca
gcagcggttggatccggaggagtgggcgtgggtgtgggagtcggcgtggttggccaaagg
cggcacataaccggacccgccgcgcaggtgagcatctctcaaagtgtcggcagtggcagc
agcggctcggccaccggtgccagcagcagcgatgcctcctcgtcgtcgcccatggtgggc
gtttgtgttcaacagaatcctgtagttatacattag

DBGET integrated database retrieval system