KEGG   Drosophila simulans: Dsim_GD15658Help
Entry
Dsim_GD15658      CDS       T01065                                 

Definition
GD15658 gene product from transcript GD15658-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 911 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSGGSVDAAQGSGSGGGRQRHAPLYGRFVDAEDLPA
THRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAKKK
RRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVK
AYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLC
LVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILL
CNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMH
TGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGRKY
KPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQ
HNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGVGGGLGTSNSSSGAVSSSSA
AAPTAATAAATAAGSSGSGSSVGGGSSAAQQQQAMPLPLPLPLPLPPLAGPGGASDGQCH
GLLMHSAAANAMNNFSALSLQSNAHPPPSLANSHHSTNSLGSLNHISPGSSGCHNNNSSS
SNNNTRHSRLYGSNMVNMVGHHNSSSNNHNSISYPHAMECDPPQMPPPPPNGHGRMRVPA
IMQLQPNSFAPNSVPYYGNMSSSSVAAAAAAAAAAASHLMMTDSSVISASAAGGGQGGGN
PGQNPVTPSAAAFLFPSQPAGTLYGTALGSLSDLPLPMPLPMSVPLPLPPSSSSSVSSGS
AAVGSGGVGVGVGVGVVGQRRHITGPAAQVSISQSVGSGSSGSATGASSSDASSSSPMVG
VCVQQNPVVIH
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaactg
tccgcttatgggtccagcgggggcagcgtcgacgcagcgcagggcagcggaagcgggggc
ggaagacagcgccacgcccccctctacgggcgattcgtcgacgcagaggatctgcctgcc
acgcaccgggatgtcatgcaccatcactctagtccctcgtcttcgtcggaggtgcgcgcc
atgcaggcccggattcccaaccactttcgggagcccgcctcgggacctttgcgcaagctg
agtgtcgatctgataaagacctacaagcacatcaacgaggtttactatgcgaaaaagaaa
cgtcgtgcccagcagacgcaaggagacgacgactcatctaacaaaaaggagcgaaaactt
tataacgacggctacgacgacgataatcacgactatataatcaagaatggcgaaaagttt
ttggatcgctacgagatcgactctctgatcggcaaaggcagttttggccaggtggtgaag
gcttacgaccacgaggagcagtgccacgtggcgatcaagataattaagaataagaaaccg
ttcctaaaccaggcacagatcgaggtcaagttgctcgagatgatgaatcgggcggatgcc
gaaaacaaatactacatcgttaagctcaagcggcacttcatgtggcgcaaccacctgtgc
ctggtgttcgagctgctctcatacaacctgtacgacctgctgcggaacaccaacttccgg
ggcgtttcgctgaacctcacgcgcaagttcgcccagcagctgtgcaccgcactgctcttc
ctcagcacccccgaactgaacataattcactgtgatttgaagcccgagaacatcctgctg
tgcaacccgaagcgctcggcgatcaagatcgttgactttggcagctcctgccagttggga
cagcggatctaccactacatccagtcgcgcttctaccgctcgccggaggtgctgcttggc
atccagtatgacctggccatcgacatgtggtcactgggctgcatcttagtcgagatgcac
accggcgagccgctcttctccggctgcaacgaggtggaccagatgaacaagatcgtcgag
gtgctgggcatgccgcccaagtatctgctcgaccaggcgcacaagacccgcaagttcttc
gacaagatcgtcgccgatggctcctatgttctgaagaagaatcagaacggcaggaagtac
aagccaccaggatcccgcaagcttcacgacatcctcggagtggaaacaggcggtccaggc
ggcaggcgtctcgatgagccgggccactctgtctcagactatctgaagttcaaggatctg
atcctgcgcatgctcgactttgaccccaagacacgggtcacgccctactatgccctgcag
cacaacttcttcaagcgcacggcagacgaggcaaccaacacgagcggcgcgggcgccaca
gcgaacgcaggagccggtggctccggttccagcggagcaggaggctccagcggcggaggc
gtcggcggcggcctcggaacgagcaacagcagtagcggtgcggtctcctcatccagtgca
gcggctccaacggcggcgacagcagcggccacggccgcaggatcgtccggttcgggttca
agtgtcggcgggggatcctccgcagcgcagcaacagcaggcgatgccgctgccattgccg
cttcccttgccgttgccaccactcgcgggtcctggcggtgcgtcagatggccaatgtcac
ggcctgcttatgcattcggcggcggccaacgcgatgaacaacttctccgctctgagcctg
cagtccaacgcccatccgccgccatcgctggccaatagccaccacagcaccaacagtctg
ggcagcctgaatcacatcagtcccggcagctccggctgccacaacaacaacagcagcagc
agcaacaacaacacacgccacagtcgtctgtacggcagcaacatggtgaacatggtgggc
caccacaacagcagcagcaacaaccacaacagcatcagctatccgcacgccatggaatgt
gatccgccgcagatgccgccaccgccgccaaacggacacggcaggatgcgagtgccggcg
ataatgcagcttcaaccgaacagctttgcgcccaattcggtgccctattacggcaacatg
tcctcgtcgtcggtggctgcggcggcggcagcggcagcagctgctgcctcgcacctaatg
atgaccgattcgagtgtgattagcgcctctgcggcgggcggtggccagggtggcggcaat
cccggccagaatccggttacgccgtcagctgccgcctttctcttcccatctcagcccgcc
ggaacgctctatggcacggcgctcggttcgctgagcgacctgccactgccgatgccactg
cccatgtccgtgcccctgccactgccgccctcgtcgtcgtcgtccgtctcctcaggatca
gcagcggttggatccggaggagtgggcgtgggtgtgggagtcggcgtggttggccaaagg
cggcacataaccggacccgccgcgcaggtgagcatctctcaaagtgtcggcagtggcagc
agcggctcggccaccggtgccagcagcagcgatgcctcctcgtcgtcgcccatggtgggc
gtttgtgttcaacagaatcctgtagttatacattag

DBGET integrated database retrieval system