KEGG   Drosophila simulans: Dsim_GD15806Help
Entry
Dsim_GD15806      CDS       T01065                                 

Definition
GD15806 gene product from transcript GD15806-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dsi  Drosophila simulans
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dsi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 302 aa AA seqDB search
MAEVLNLESIIARLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggttctcaatctggagagcataattgcccgtctattggaggtgcgtggcgcc
cggcccggcaagaatgtgcagctgtcggagggcgagatacgaggattgtgcctcaagtca
cgagagatactgctggcgcagcccatactgttggagctggaggcgccgctcaagatttgc
ggcgatatccatggccagtactatgatctgttgcgtctgttcgagtacggcggctatccg
ccggaggctaactatctcttcttgggcgactacgtggacaggggcaagcagtcgctggag
accatctgcctgctgttggcgtacaagatcaaatattcggagaacttctttttgctgcgc
ggcaatcacgagtgcgccagcattaatagaatctatggattctacgacgagtgcaagcga
cgatataccatcaagttgtggaagacattcacggactgcttcaactgtctgccggtggtg
gccattgtggacgagaagatcttttgctgccacggcggactgagtccggatctcacctcg
atggagcagatccgtcgtattatgcgtcccaccgatgtgcccgatcagggactgctctgt
gacttgctgtggtccgatccggacaaggacaccattggatggggcgagaacgaccgtggc
gttagcttcacctttggcgccgaggtggtggtcaagtttctccagaagcacgatctggat
ctgatctgtcgtgcccatcaggtcgtcgaggatggttacgagttcttcgccaagcgccaa
ttggtcaccctcttttccgctcccaactattgcggtgaatttgacaatgctggtgccatg
atgtccgtggacaatacacttatgtgctccttccaaatcctgaagcccgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system