KEGG   Drosophila simulans: Dsimw501_GD15872Help
Entry
Dsimw501_GD15872  CDS       T01065                                 

Gene name
Dsim_GD15872
Definition
(RefSeq) GD15872 gene product from transcript GD15872-RA (EC:5.-.-.-)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD15872 (Dsim_GD15872)
   00052 Galactose metabolism
    Dsimw501_GD15872 (Dsim_GD15872)
Enzymes [BR:dsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dsimw501_GD15872 (Dsim_GD15872)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Unknown
AA seq 392 aa AA seqDB search
MVKVVEDIFGIATNPFTKQAQVIRRYTMTNTNRLSVAIIQLGATIQSIQVPDAYHQLSDV
VLGFDDVAGYTKYRNYHFGCTIGRVSDVVGNGEFIMDERRVIVSKNLGQKHQIDGGFVGF
DQVIWDLEMKRPDGVTLRHVSPDGHEGYPGTLKVLLHFTINDDNRFFIQMEATTNQTTPV
NISNHIIFNLAGQSTGIKGIFDHQINIEAMETMETSKGDGLPTGRFKNVNDSVYDIRLPV
FMGDRVRQFEQKPVKGYDVCFALDKEFDSIRTRYVGRFLHPDSGRFMEIFSNQPCVRFTT
GNCFPQEPLGEPPILGKRCTRYWQHCGFSLQLLNYPDAVNQPDFPRIFINPGEHYFHETI
YHFGVQESWKCCADPEELKALGEEPLRKPKPV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggttgtggaggacatctttggtattgcgaccaatccgtttaccaagcaggcc
caagtgattcgtcgctatacgatgaccaacaccaatcgcctgtccgtggccatcatccag
ctgggcgcaacaatccagagcattcaagtgccagatgcctatcaccagttgtccgatgtg
gtccttggattcgatgatgttgccgggtatacgaagtataggaactatcattttggttgc
acaattggcagagtctcggatgtggtgggcaacggcgagttcatcatggacgagcgacgg
gtcattgtgtccaaaaatttggggcagaagcaccagattgatggtggctttgtgggcttc
gatcaggtcatttgggatctggaaatgaaacggccggatggcgtcaccttgcgtcatgtc
tccccggatggacacgaaggatatcctgggacattgaaagtattgcttcacttcaccata
aatgacgataatcggttctttatacaaatggaagccaccactaatcaaacgacgccggtg
aatatatccaatcatatcatctttaatctggccggtcagtctaccggaatcaagggcatt
tttgaccatcaaatcaacattgaggcaatggaaacgatggaaacatccaaaggcgacgga
cttcccacgggtcgatttaagaacgttaatgattccgtatacgatatccgattgccagta
ttcatgggcgaccgggtgcgccagtttgaacagaaaccggtaaagggttacgacgtttgc
tttgccctcgacaaggagttcgattcaattagaacgcgttatgtgggcaggtttttgcat
ccggattcggggagatttatggaaatattcagcaatcagccgtgtgttaggttcaccacc
ggcaattgttttccccaggaaccgcttggtgagccacctatattgggtaaaaggtgcacc
cgctattggcaacattgtggcttcagtcttcagctgcttaactatccggatgccgtaaat
cagccggattttccacgcatcttcatcaatccgggcgagcactatttccatgaaaccatc
taccattttggcgttcaggaatcgtggaaatgctgtgccgatccggaggaactgaaagcc
ctgggcgaagaaccactgcgaaaaccaaaacccgtttga

DBGET integrated database retrieval system