KEGG   Drosophila simulans: Dsimw501_GD15909Help
Entry
Dsimw501_GD15909  CDS       T01065                                 

Gene name
Dsim_GD15909
Definition
(RefSeq) GD15909 gene product from transcript GD15909-RD
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
Protein processing in endoplasmic reticulum
Apoptosis - fly
Toll and Imd signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsimw501_GD15909 (Dsim_GD15909)
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD15909 (Dsim_GD15909)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD15909 (Dsim_GD15909)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dsimw501_GD15909 (Dsim_GD15909)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsimw501_GD15909 (Dsim_GD15909)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dsimw501_GD15909 (Dsim_GD15909)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 1185 aa AA seqDB search
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPGVSGSVPSARVPPLATSASAAT
SAAHAPPLGAGSVSGSGISIAQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGAFG
GTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDKKLKIIMEQT
GKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRI
LMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVT
VATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAY
MAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYG
EGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRTYEIAKVDVPNWFQSIKDNRLRA
NGDPTLQRATATGSAVGSGAGSLAGSGSAGGAVKYGRATPYAGQSPTNPQKTIKPTQIPS
YQQQQSQFFMQSATQLPQTTTTTPTATTNCFGGSGNGNGRGNGSGGSGNGSGSSSSASPL
SPPSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLTTS
PFSQKKHNSAAATATTIPLPHNNQTLITDAATAAAAAAAATATTPPNIAATALTTTPTTT
PTWRLPADNSQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQQ
QQQPQRLQPGNQSPIVLQRFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPP
PPSTHSTSSQSSTQSTCSQIAINPASISPSSGSGTGNVSGLGIGSAPASGLGAAGHFGAG
GSGEQLQYQPLPIAAEATGTSPTLQPRSPEQQSDYGGSGNMVASKLSKLYARRQLLGQSS
SSGASNSSLDGCSREQHDAGWFNTLAGAMKRQFATYVKTQLNSTATSPVASSMDRDQEPV
HPQPPAYRSVVNNGSGGKSYYYRTLSAASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASS
GPGGSISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQQPGSPLLHRR
YVSASPPLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccattgagttcgagacgatcggcagtcggctgcaatctttggaggcgaagctc
caggcgcagaatgagtcccacgaccagatcgtcctttccggtgcgcgcggccctggcgtt
tccggttccgttccgtctgcccgcgttccgcccctggcgacatccgcatccgcagccaca
tccgccgcccacgcaccgcccctgggcgcaggttccgtttccggatcgggtatcagcata
gcccagcggccagcacctccagttcctcatgcgacgcccttcggcagcgccagcgcctcg
tcatcatcctcatccgcatccgcatttgcatccgcagcaccggcgacgggcgcgttcggt
ggaacatacaccccgcccacaactagagtgtcgcgagccacgcccacactgcccatgctt
tctagtggtcccggtggcggactgaatcggacgcggccggtgatacttccgctgcccacg
ccgccacatccaccggtttcggaaacggacaagaagctgaagatcatcatggagcagacc
ggcaagctgaacatcaacgggcggcagtatccgacggacatcaatgacctcaagcacctg
ggcgacctgggcaatgggactagcggcaatgtggtgaagatgatgcacctgtccagcaac
acgatcatcgccgtgaagcagatgcgacgcactggcaacgcggaggagaacaagcgcatc
ctgatggatctggatgttgtgctcaagtcgcacgactgcaagtacattgtcaagtgcctc
ggctgctttgttcgcgatccggatgtgtggatctgcatggagctgatgtccatgtgcttc
gacaagctgctcaagctgtccaagaagccggtgccggaacagatcctgggcaaggtcaca
gtggcgacggtcaacgcattgtcctatctgaaggacaagcacggggtcatccatcgagat
gtgaagccctcgaacattctgatcgacgagcgcgggaacatcaagctctgtgatttcggg
atcagcggtcgcctggtggactccaaggccaacactcgatccgcgggctgtgcagcttat
atggcgccggagcgcatcgaccccaagaaaccaaagtacgacattcgcgcagatgtatgg
tcactgggcataacgctggtggagctggccaccgcgcgatccccgtacgagggatgcaac
acggacttcgaggtgctcaccaaggtgcttgactcggagccgccgtgtttgccatacggc
gagggctacaactttagtcagcagttccgcgatttcgtcatcaagtgcctcacaaagaac
catcaggatcgacccaagtatccggagcttctggcccagcccttcatccggacttatgaa
atagccaaagtagatgtgcccaattggtttcagagcatcaaggataaccgactgcgcgcc
aatggcgatccaacgctccagagggcaacggcgactggaagtgcggtcggttctggggcc
ggatctctcgcaggatcaggatccgcaggtggagctgtaaaatatggtagggcgacgccg
tatgccgggcagagtcccacaaatccgcagaagacaataaaacccactcagataccgagt
taccagcagcaacagtcgcagtttttcatgcaatcagccacacaactacctcaaacaaca
accacaacaccgacggcaacgacgaactgtttcggcggcagcggaaacggaaatggaaga
ggaaacggcagcggcggaagcggaaatggtagcggaagcagcagcagtgccagtcctcta
tcgccaccaagcgccggaatcggcgatcttaaccggctttatcgcaaatcgccgttcatg
cagcgaaaactgagcaacggatcccatcatccgcactacaaatataacgacgagagcccc
aagaaggagtccatgttcagtagcatcggtcaatcgattctacgcaatctgacaacatcg
cccttcagccaaaagaaacacaattcagcagcagcgactgcaacaacaataccactgccg
cacaacaaccaaacattgattacggatgcagcaacagcagcagcagcagcagcagcggca
acagcaacaacaccgccaaatattgcagctacagcgctcacgacaacgccaacgaccacg
cccacttggcgcctgccagcggacaattcccaagcctacgacagctgtgatagtagtagt
aatgcgaccacgacgaccttgaatttgggcctctcctcaccctccccctcgttgccgcgc
aagcaattccccacagaatcgccgaccctgcaactcacgagtcagcagcagcagcagcag
cagcaacaaccacagcgattgcagccgggcaatcaaagtcccatagtgctgcagcgcttc
taccaccagcagaatcagctacgcgagaaggaggcggccgagcggtatcagcagcagcgc
cagcagccgcccgtgggagtgaccagcacgaatccgtttcacagcaactatgtgccgccg
ccgccatcaacgcactccacctctagtcagtcctccacgcagtcgacgtgttcacaaatc
gccatcaatcccgccagcatatctccatcgtctggttccggaacgggaaacgtgtcggga
ttgggaatcggatcggctccggcatcgggattgggggcagctggtcactttggagcgggc
ggctctggcgagcagctgcagtatcagccgctgcccatcgcggccgaggcaacgggaacg
agtcccacgctccagcccagatcaccggaacagcagtcggattatggaggaagcggtaac
atggtggccagcaagctgagcaaactgtacgcacgccgacaactgttgggccagagctcc
agcagcggagcgagcaatagcagcctggacggatgcagtcgggagcaacacgatgcaggc
tggttcaacactcttgctggtgccatgaagcgacagtttgccacctatgttaaaacccaa
ttgaattccacagccacgtcgccggtggcgtccagcatggatcgggaccaggagccagtg
catccgcagccgccggcgtacaggagcgtcgtgaataacggcagcggcggtaagtcctac
tactatcgcaccttgtcggcggccagcagcagcagtaataccagccagagcacctcgccc
acgacggaaccactgcccggcggtggcaccagtagcttcctgcgtcgctatgccagcagc
ggaccgggaggtagcatcagcacgccgcccagtccgcatatcttggcgggattggatcgc
aggcatcgaagtccagatccgccgccacgctacaatcgcggacagtcgccgctgttgctg
cgcaagaatctgctggagctgagtggccagcagcccggctctccgttgctgcaccgcaga
tacgtttcggcctcaccgccgctgccgccaccgcgtcgaggttctgaaagcgtgccggga
tcaccgcagcatttccgcactcgcatccactatacacccgagccccagagacgcatctac
cgtacgatagatcaatga

DBGET integrated database retrieval system