KEGG   Drosophila simulans: Dsim_GD15909Help
Entry
Dsim_GD15909      CDS       T01065                                 

Definition
GD15909 gene product from transcript GD15909-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dsi  Drosophila simulans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsim_GD15909
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsim_GD15909
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dsim_GD15909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1047 aa AA seqDB search
MELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERG
NIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATA
RSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLA
QPFIRTYEIAKVDVPNWFQSIKDNRLRANGDPTLQSIIPTTRPLYPADDVLCLLWMCVNN
VWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLT
KNHQDRPKYPELLAQPFIRTYEIAKVDVPNWFQSIKDNRLRANGDPTLQRATATGSAVGS
GAGSLAGSGSAGGAVKYGRATPYAGQSPTNPQKTIKPTQIPSYQQQQSQFFMQSATQLPQ
TTTTTPTATTNCFGGSGNGNGRGNGSGGSGNGSGSSSSASPLSPPSAGIGDLNRLYRKSP
FMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLTTSPFSQKKHNSAAATATTIP
LPHNNQTLITDAATAAAAAAAATATTPPNIAATALTTTPTTTPTWRLPADNSQAYDSCDS
SSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQQQQQPQRLQPGNQSPIVLQ
RFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTHSTSSQSSTQSTCS
QIAINPASISPSSGSGTGNVSGLGIGSAPASGLGAAGHFGAGGSGEQLQYQPLPIAAEAT
GTSPTLQPRSPEQQSDYGGSGNMVASKLSKLYARRQLLGQSSSSGASNSSLDGCSREQHD
AGWFNTLAGAMKRQFATYVKTQLNSTATSPVASSMDRDQEPVHPQPPAYRSVVNNGSGGK
SYYYRTLSAASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASSGPGGSISTPPSPHILAGL
DRRHRSPDPPPRYNRGQSPLLLRMKGLELSGQQPGSPLLHRRYVSASPPLPPPRRGSESV
PGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggagctgatgtccatgtgcttcgacaagctgctcaagctgtccaagaagccggtgccg
gaacagatcctgggcaaggtcacagtggcgacggtcaacgcattgtcctatctgaaggac
aagcacggggtcatccatcgagatgtgaagccctcgaacattctgatcgacgagcgcggg
aacatcaagctctgtgatttcgggatcagcggtcgcctggtggactccaaggccaacact
cgatccgcgggctgtgcagcttatatggcgccggagcgcatcgaccccaagaaaccaaag
tacgacattcgcgcagatgtatggtcactgggcataacgctggtggagctggccaccgcg
cgatccccgtacgagggatgcaacacggacttcgaggtgctcaccaaggtgcttgactcg
gagccgccgtgtttgccatacggcgagggctacaactttagtcagcagttccgcgatttc
gtcatcaagtgcctcacaaagaaccatcaggatcgacccaagtatccggagcttctggcc
cagcccttcatccggacttatgaaatagccaaagtagatgtgcccaattggtttcagagc
atcaaggataaccgactgcgcgccaatggcgatccaacgctccagagcattattcccacg
acccgtccgctatacccggctgatgatgtgttgtgcctgttgtggatgtgtgtgaataat
gtatggtcactgggcataacgctggtggagctggccaccgcgcgatccccgtacgaggga
tgcaacacggacttcgaggtgctcaccaaggtgcttgactcggagccgccgtgtttgcca
tacggcgagggctacaactttagtcagcagttccgcgatttcgtcatcaagtgcctcaca
aagaaccatcaggatcgacccaagtatccggagcttctggcccagcccttcatccggact
tatgaaatagccaaagtagatgtgcccaattggtttcagagcatcaaggataaccgactg
cgcgccaatggcgatccaacgctccagagggcaacggcgactggaagtgcggtcggttct
ggggccggatctctcgcaggatcaggatccgcaggtggagctgtaaaatatggtagggcg
acgccgtatgccgggcagagtcccacaaatccgcagaagacaataaaacccactcagata
ccgagttaccagcagcaacagtcgcagtttttcatgcaatcagccacacaactacctcaa
acaacaaccacaacaccgacggcaacgacgaactgtttcggcggcagcggaaacggaaat
ggaagaggaaacggcagcggcggaagcggaaatggtagcggaagcagcagcagtgccagt
cctctatcgccaccaagcgccggaatcggcgatcttaaccggctttatcgcaaatcgccg
ttcatgcagcgaaaactgagcaacggatcccatcatccgcactacaaatataacgacgag
agccccaagaaggagtccatgttcagtagcatcggtcaatcgattctacgcaatctgaca
acatcgcccttcagccaaaagaaacacaattcagcagcagcgactgcaacaacaatacca
ctgccgcacaacaaccaaacattgattacggatgcagcaacagcagcagcagcagcagca
gcggcaacagcaacaacaccgccaaatattgcagctacagcgctcacgacaacgccaacg
accacgcccacttggcgcctgccagcggacaattcccaagcctacgacagctgtgatagt
agtagtaatgcgaccacgacgaccttgaatttgggcctctcctcaccctccccctcgttg
ccgcgcaagcaattccccacagaatcgccgaccctgcaactcacgagtcagcagcagcag
cagcagcagcaacaaccacagcgattgcagccgggcaatcaaagtcccatagtgctgcag
cgcttctaccaccagcagaatcagctacgcgagaaggaggcggccgagcggtatcagcag
cagcgccagcagccgcccgtgggagtgaccagcacgaatccgtttcacagcaactatgtg
ccgccgccgccatcaacgcactccacctctagtcagtcctccacgcagtcgacgtgttca
caaatcgccatcaatcccgccagcatatctccatcgtctggttccggaacgggaaacgtg
tcgggattgggaatcggatcggctccggcatcgggattgggggcagctggtcactttgga
gcgggcggctctggcgagcagctgcagtatcagccgctgcccatcgcggccgaggcaacg
ggaacgagtcccacgctccagcccagatcaccggaacagcagtcggattatggaggaagc
ggtaacatggtggccagcaagctgagcaaactgtacgcacgccgacaactgttgggccag
agctccagcagcggagcgagcaatagcagcctggacggatgcagtcgggagcaacacgat
gcaggctggttcaacactcttgctggtgccatgaagcgacagtttgccacctatgttaaa
acccaattgaattccacagccacgtcgccggtggcgtccagcatggatcgggaccaggag
ccagtgcatccgcagccgccggcgtacaggagcgtcgtgaataacggcagcggcggtaag
tcctactactatcgcaccttgtcggcggccagcagcagcagtaataccagccagagcacc
tcgcccacgacggaaccactgcccggcggtggcaccagtagcttcctgcgtcgctatgcc
agcagcggaccgggaggtagcatcagcacgccgcccagtccgcatatcttggcgggattg
gatcgcaggcatcgaagtccagatccgccgccacgctacaatcgcggacagtcgccgctg
ttgctgcgcatgaaagggctggagctgagtggccagcagcccggctctccgttgctgcac
cgcagatacgtttcggcctcgccgccgctgccgccaccgcgtcgaggttctgaaagcgtg
ccgggatcaccgcagcatttccgcactcgcatccactatacacccgagccccagagacgc
atctaccgtacgatagatcaatga

DBGET integrated database retrieval system